Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6CCF1

Protein Details
Accession Q6CCF1    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
79-99QQWGEVKKKVPKEKPAPAPAAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16.5, cyto_mito 9.666, nucl 7, cyto_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR003892  CUE  
IPR041803  DEF1_CUE  
Gene Ontology GO:0000781  C:chromosome, telomeric region  
GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0043130  F:ubiquitin binding  
KEGG yli:YALI0C09933g  -  
Pfam View protein in Pfam  
PF02845  CUE  
CDD cd14368  CUE_DEF1_like  
Amino Acid Sequences MSERPKRSSVSRTAVRPAKNSTSILDEESKRLKQLYPTQLVTLKELFPDWKDDDLLTVLSDTDGDLENAIIRIADGHAQQWGEVKKKVPKEKPAPAPAAAPTPAVAQQHSTSQQQSVSTSQKMPPKGPRADRSAKVGGTSAAGAKRAPTAAAAASKRAPVAAAIPTKPVAAPPAAVAGAASAASTEHRAPKAGSWASHVGVVDSQKESHGTHGASSAATAAAAAAPVSVSASTESAPSADVGSSAAAPAPAAQASSAPVAVHPAPSSAPAKKSWAAIATPKAAPKPVAPTPAAQAAPSSSTDAPAVQAAQVAVLEQQAEQEAEQSAAAEQAAAPADAPEAVQAADVAVEEASGEFDEVPKGPPGLDKSVGGNRNLPRRLNQNEAVVLPQGAAQVDQVGVQFGSLNLGGEASATQVAQTAAKDEAHQPPAEAPTQPKAEAEAAAAAAAAATQQQQQQQQQPPTAPAAEDQQQQEHPDYYQQQPYGYNPAYRYQQQPGQKQGYEQQQQQQFAHYSYPGQSQVGFNSGFGAPDMFAGTDMHRGFYPYQQGQQGGAQQGQTAQQGAQGGAQGGAQQSQGDYRSPFENGTPSAPYNDKLYSSISGQQSNTASPAGVAATPVQPGGQGQQPPQQGQPMPYGAYQYPYYGNMYYNYPFAGFNQGPQGYNSPSQQKGYYQQQGFYNQPGVPQQGGAQGQQHAQMQGGASGAESTPNQGSATPAAAKDDAADYVQSNAFGGNMPQGGYNYGQYYSQYSQQPNSRPAWQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.69
3 0.65
4 0.63
5 0.61
6 0.58
7 0.55
8 0.47
9 0.46
10 0.43
11 0.42
12 0.42
13 0.36
14 0.37
15 0.42
16 0.42
17 0.38
18 0.39
19 0.38
20 0.39
21 0.47
22 0.51
23 0.52
24 0.53
25 0.55
26 0.57
27 0.55
28 0.51
29 0.44
30 0.34
31 0.28
32 0.27
33 0.25
34 0.22
35 0.27
36 0.26
37 0.25
38 0.25
39 0.24
40 0.24
41 0.23
42 0.22
43 0.16
44 0.13
45 0.11
46 0.09
47 0.09
48 0.07
49 0.07
50 0.08
51 0.07
52 0.07
53 0.07
54 0.08
55 0.09
56 0.08
57 0.07
58 0.06
59 0.06
60 0.07
61 0.1
62 0.1
63 0.11
64 0.13
65 0.14
66 0.14
67 0.2
68 0.24
69 0.25
70 0.28
71 0.34
72 0.39
73 0.48
74 0.58
75 0.61
76 0.67
77 0.72
78 0.79
79 0.83
80 0.83
81 0.79
82 0.7
83 0.64
84 0.55
85 0.5
86 0.41
87 0.31
88 0.23
89 0.2
90 0.22
91 0.2
92 0.18
93 0.17
94 0.17
95 0.22
96 0.25
97 0.27
98 0.25
99 0.26
100 0.27
101 0.26
102 0.27
103 0.27
104 0.29
105 0.29
106 0.31
107 0.34
108 0.38
109 0.41
110 0.45
111 0.48
112 0.52
113 0.58
114 0.63
115 0.65
116 0.67
117 0.72
118 0.69
119 0.67
120 0.63
121 0.54
122 0.46
123 0.41
124 0.32
125 0.25
126 0.23
127 0.19
128 0.15
129 0.15
130 0.14
131 0.14
132 0.15
133 0.15
134 0.14
135 0.11
136 0.11
137 0.13
138 0.19
139 0.19
140 0.2
141 0.21
142 0.22
143 0.21
144 0.2
145 0.17
146 0.11
147 0.13
148 0.17
149 0.2
150 0.2
151 0.22
152 0.22
153 0.22
154 0.22
155 0.2
156 0.16
157 0.12
158 0.11
159 0.1
160 0.12
161 0.11
162 0.11
163 0.1
164 0.07
165 0.07
166 0.06
167 0.05
168 0.03
169 0.03
170 0.04
171 0.07
172 0.09
173 0.13
174 0.14
175 0.16
176 0.17
177 0.19
178 0.27
179 0.28
180 0.26
181 0.27
182 0.29
183 0.28
184 0.29
185 0.27
186 0.19
187 0.18
188 0.19
189 0.16
190 0.14
191 0.14
192 0.12
193 0.14
194 0.14
195 0.15
196 0.17
197 0.15
198 0.15
199 0.16
200 0.16
201 0.14
202 0.13
203 0.11
204 0.07
205 0.06
206 0.05
207 0.04
208 0.03
209 0.04
210 0.03
211 0.03
212 0.03
213 0.03
214 0.03
215 0.03
216 0.04
217 0.04
218 0.05
219 0.06
220 0.06
221 0.06
222 0.06
223 0.07
224 0.06
225 0.06
226 0.06
227 0.05
228 0.05
229 0.06
230 0.06
231 0.05
232 0.05
233 0.04
234 0.04
235 0.05
236 0.05
237 0.05
238 0.05
239 0.05
240 0.05
241 0.06
242 0.07
243 0.07
244 0.06
245 0.06
246 0.09
247 0.09
248 0.1
249 0.09
250 0.09
251 0.09
252 0.12
253 0.15
254 0.15
255 0.17
256 0.17
257 0.22
258 0.22
259 0.23
260 0.22
261 0.21
262 0.2
263 0.23
264 0.25
265 0.24
266 0.24
267 0.25
268 0.24
269 0.22
270 0.22
271 0.19
272 0.22
273 0.22
274 0.24
275 0.24
276 0.24
277 0.25
278 0.29
279 0.27
280 0.21
281 0.18
282 0.14
283 0.14
284 0.14
285 0.15
286 0.1
287 0.11
288 0.11
289 0.11
290 0.11
291 0.09
292 0.09
293 0.06
294 0.06
295 0.05
296 0.05
297 0.05
298 0.05
299 0.04
300 0.04
301 0.04
302 0.04
303 0.04
304 0.05
305 0.05
306 0.05
307 0.05
308 0.05
309 0.05
310 0.05
311 0.05
312 0.05
313 0.05
314 0.05
315 0.04
316 0.03
317 0.04
318 0.05
319 0.04
320 0.04
321 0.04
322 0.04
323 0.04
324 0.04
325 0.03
326 0.03
327 0.03
328 0.03
329 0.03
330 0.03
331 0.03
332 0.03
333 0.03
334 0.03
335 0.02
336 0.03
337 0.03
338 0.03
339 0.03
340 0.03
341 0.03
342 0.03
343 0.04
344 0.05
345 0.06
346 0.06
347 0.06
348 0.06
349 0.09
350 0.11
351 0.14
352 0.14
353 0.14
354 0.16
355 0.22
356 0.24
357 0.23
358 0.26
359 0.26
360 0.33
361 0.35
362 0.33
363 0.3
364 0.36
365 0.39
366 0.39
367 0.38
368 0.32
369 0.31
370 0.3
371 0.28
372 0.21
373 0.17
374 0.11
375 0.09
376 0.07
377 0.06
378 0.05
379 0.04
380 0.04
381 0.05
382 0.05
383 0.04
384 0.04
385 0.04
386 0.04
387 0.04
388 0.03
389 0.04
390 0.04
391 0.04
392 0.04
393 0.04
394 0.04
395 0.04
396 0.04
397 0.03
398 0.04
399 0.03
400 0.03
401 0.04
402 0.05
403 0.05
404 0.05
405 0.06
406 0.07
407 0.08
408 0.09
409 0.12
410 0.16
411 0.17
412 0.18
413 0.16
414 0.17
415 0.19
416 0.19
417 0.17
418 0.14
419 0.16
420 0.18
421 0.18
422 0.17
423 0.16
424 0.16
425 0.15
426 0.14
427 0.1
428 0.08
429 0.07
430 0.07
431 0.05
432 0.04
433 0.03
434 0.03
435 0.02
436 0.03
437 0.05
438 0.07
439 0.11
440 0.15
441 0.19
442 0.27
443 0.33
444 0.36
445 0.37
446 0.36
447 0.35
448 0.33
449 0.29
450 0.22
451 0.16
452 0.16
453 0.17
454 0.19
455 0.18
456 0.19
457 0.2
458 0.21
459 0.22
460 0.19
461 0.16
462 0.17
463 0.2
464 0.21
465 0.25
466 0.23
467 0.23
468 0.23
469 0.25
470 0.28
471 0.26
472 0.25
473 0.22
474 0.25
475 0.28
476 0.3
477 0.32
478 0.29
479 0.33
480 0.38
481 0.42
482 0.47
483 0.49
484 0.46
485 0.44
486 0.46
487 0.5
488 0.47
489 0.45
490 0.44
491 0.44
492 0.46
493 0.45
494 0.42
495 0.34
496 0.3
497 0.28
498 0.21
499 0.17
500 0.16
501 0.19
502 0.17
503 0.15
504 0.16
505 0.15
506 0.15
507 0.17
508 0.15
509 0.12
510 0.13
511 0.13
512 0.11
513 0.1
514 0.1
515 0.07
516 0.07
517 0.08
518 0.05
519 0.06
520 0.07
521 0.07
522 0.13
523 0.13
524 0.13
525 0.13
526 0.15
527 0.16
528 0.18
529 0.25
530 0.22
531 0.26
532 0.27
533 0.28
534 0.27
535 0.28
536 0.28
537 0.23
538 0.22
539 0.18
540 0.16
541 0.16
542 0.17
543 0.15
544 0.12
545 0.1
546 0.1
547 0.11
548 0.11
549 0.11
550 0.09
551 0.09
552 0.09
553 0.09
554 0.08
555 0.07
556 0.08
557 0.07
558 0.07
559 0.07
560 0.09
561 0.1
562 0.11
563 0.12
564 0.13
565 0.15
566 0.16
567 0.17
568 0.16
569 0.19
570 0.19
571 0.2
572 0.21
573 0.2
574 0.22
575 0.23
576 0.23
577 0.22
578 0.22
579 0.21
580 0.19
581 0.21
582 0.19
583 0.2
584 0.26
585 0.25
586 0.27
587 0.26
588 0.29
589 0.28
590 0.27
591 0.25
592 0.19
593 0.16
594 0.12
595 0.12
596 0.09
597 0.08
598 0.08
599 0.08
600 0.09
601 0.09
602 0.09
603 0.08
604 0.08
605 0.08
606 0.1
607 0.14
608 0.16
609 0.18
610 0.25
611 0.29
612 0.31
613 0.32
614 0.35
615 0.32
616 0.32
617 0.33
618 0.29
619 0.28
620 0.26
621 0.28
622 0.23
623 0.24
624 0.22
625 0.19
626 0.19
627 0.19
628 0.21
629 0.18
630 0.19
631 0.18
632 0.21
633 0.2
634 0.19
635 0.18
636 0.16
637 0.15
638 0.15
639 0.22
640 0.19
641 0.19
642 0.26
643 0.27
644 0.27
645 0.29
646 0.31
647 0.27
648 0.3
649 0.33
650 0.32
651 0.33
652 0.35
653 0.35
654 0.36
655 0.4
656 0.45
657 0.5
658 0.46
659 0.47
660 0.49
661 0.53
662 0.51
663 0.47
664 0.42
665 0.33
666 0.33
667 0.32
668 0.31
669 0.26
670 0.24
671 0.22
672 0.23
673 0.25
674 0.23
675 0.23
676 0.22
677 0.23
678 0.25
679 0.26
680 0.2
681 0.19
682 0.19
683 0.16
684 0.15
685 0.14
686 0.1
687 0.08
688 0.09
689 0.08
690 0.09
691 0.09
692 0.11
693 0.12
694 0.13
695 0.13
696 0.13
697 0.15
698 0.15
699 0.18
700 0.18
701 0.17
702 0.2
703 0.2
704 0.19
705 0.18
706 0.18
707 0.15
708 0.14
709 0.14
710 0.12
711 0.15
712 0.16
713 0.14
714 0.13
715 0.12
716 0.11
717 0.11
718 0.11
719 0.11
720 0.11
721 0.12
722 0.13
723 0.13
724 0.15
725 0.17
726 0.18
727 0.16
728 0.17
729 0.17
730 0.17
731 0.23
732 0.23
733 0.28
734 0.33
735 0.35
736 0.41
737 0.48
738 0.55
739 0.55