FuNGI

Q6CCF1

Protein Details

Accession

Q6CCF1

Localization Confidence

Low

Confidence Score

6.8

NoLS Segment(s)

Position	Sequence	Protein Nature
79-99	QQWGEVKKKVPKEKPAPAPAA	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 16.5, cyto_mito 9.666, nucl 7, cyto_nucl 5.333

Family & Domain DBs

InterPro	View protein in InterPro IPR003892 CUE IPR041803 DEF1_CUE
Gene Ontology	GO:0000781 C:chromosome, telomeric region GO:0005737 C:cytoplasm GO:0005634 C:nucleus GO:0043130 F:ubiquitin binding
KEGG	yli:YALI0C09933g -
Pfam	View protein in Pfam PF02845 CUE
CDD	cd14368 CUE_DEF1_like

Amino Acid Sequences

MSERPKRSSVSRTAVRPAKNSTSILDEESKRLKQLYPTQLVTLKELFPDWKDDDLLTVLSDTDGDLENAIIRIADGHAQQWGEVKKKVPKEKPAPAPAAAPTPAVAQQHSTSQQQSVSTSQKMPPKGPRADRSAKVGGTSAAGAKRAPTAAAAASKRAPVAAAIPTKPVAAPPAAVAGAASAASTEHRAPKAGSWASHVGVVDSQKESHGTHGASSAATAAAAAAPVSVSASTESAPSADVGSSAAAPAPAAQASSAPVAVHPAPSSAPAKKSWAAIATPKAAPKPVAPTPAAQAAPSSSTDAPAVQAAQVAVLEQQAEQEAEQSAAAEQAAAPADAPEAVQAADVAVEEASGEFDEVPKGPPGLDKSVGGNRNLPRRLNQNEAVVLPQGAAQVDQVGVQFGSLNLGGEASATQVAQTAAKDEAHQPPAEAPTQPKAEAEAAAAAAAAATQQQQQQQQQPPTAPAAEDQQQQEHPDYYQQQPYGYNPAYRYQQQPGQKQGYEQQQQQQFAHYSYPGQSQVGFNSGFGAPDMFAGTDMHRGFYPYQQGQQGGAQQGQTAQQGAQGGAQGGAQQSQGDYRSPFENGTPSAPYNDKLYSSISGQQSNTASPAGVAATPVQPGGQGQQPPQQGQPMPYGAYQYPYYGNMYYNYPFAGFNQGPQGYNSPSQQKGYYQQQGFYNQPGVPQQGGAQGQQHAQMQGGASGAESTPNQGSATPAAAKDDAADYVQSNAFGGNMPQGGYNYGQYYSQYSQQPNSRPAWQ

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.71
2	0.69
3	0.65
4	0.63
5	0.61
6	0.58
7	0.55
8	0.47
9	0.46
10	0.43
11	0.42
12	0.42
13	0.36
14	0.37
15	0.42
16	0.42
17	0.38
18	0.39
19	0.38
20	0.39
21	0.47
22	0.51
23	0.52
24	0.53
25	0.55
26	0.57
27	0.55
28	0.51
29	0.44
30	0.34
31	0.28
32	0.27
33	0.25
34	0.22
35	0.27
36	0.26
37	0.25
38	0.25
39	0.24
40	0.24
41	0.23
42	0.22
43	0.16
44	0.13
45	0.11
46	0.09
47	0.09
48	0.07
49	0.07
50	0.08
51	0.07
52	0.07
53	0.07
54	0.08
55	0.09
56	0.08
57	0.07
58	0.06
59	0.06
60	0.07
61	0.1
62	0.1
63	0.11
64	0.13
65	0.14
66	0.14
67	0.2
68	0.24
69	0.25
70	0.28
71	0.34
72	0.39
73	0.48
74	0.58
75	0.61
76	0.67
77	0.72
78	0.79
79	0.83
80	0.83
81	0.79
82	0.7
83	0.64
84	0.55
85	0.5
86	0.41
87	0.31
88	0.23
89	0.2
90	0.22
91	0.2
92	0.18
93	0.17
94	0.17
95	0.22
96	0.25
97	0.27
98	0.25
99	0.26
100	0.27
101	0.26
102	0.27
103	0.27
104	0.29
105	0.29
106	0.31
107	0.34
108	0.38
109	0.41
110	0.45
111	0.48
112	0.52
113	0.58
114	0.63
115	0.65
116	0.67
117	0.72
118	0.69
119	0.67
120	0.63
121	0.54
122	0.46
123	0.41
124	0.32
125	0.25
126	0.23
127	0.19
128	0.15
129	0.15
130	0.14
131	0.14
132	0.15
133	0.15
134	0.14
135	0.11
136	0.11
137	0.13
138	0.19
139	0.19
140	0.2
141	0.21
142	0.22
143	0.21
144	0.2
145	0.17
146	0.11
147	0.13
148	0.17
149	0.2
150	0.2
151	0.22
152	0.22
153	0.22
154	0.22
155	0.2
156	0.16
157	0.12
158	0.11
159	0.1
160	0.12
161	0.11
162	0.11
163	0.1
164	0.07
165	0.07
166	0.06
167	0.05
168	0.03
169	0.03
170	0.04
171	0.07
172	0.09
173	0.13
174	0.14
175	0.16
176	0.17
177	0.19
178	0.27
179	0.28
180	0.26
181	0.27
182	0.29
183	0.28
184	0.29
185	0.27
186	0.19
187	0.18
188	0.19
189	0.16
190	0.14
191	0.14
192	0.12
193	0.14
194	0.14
195	0.15
196	0.17
197	0.15
198	0.15
199	0.16
200	0.16
201	0.14
202	0.13
203	0.11
204	0.07
205	0.06
206	0.05
207	0.04
208	0.03
209	0.04
210	0.03
211	0.03
212	0.03
213	0.03
214	0.03
215	0.03
216	0.04
217	0.04
218	0.05
219	0.06
220	0.06
221	0.06
222	0.06
223	0.07
224	0.06
225	0.06
226	0.06
227	0.05
228	0.05
229	0.06
230	0.06
231	0.05
232	0.05
233	0.04
234	0.04
235	0.05
236	0.05
237	0.05
238	0.05
239	0.05
240	0.05
241	0.06
242	0.07
243	0.07
244	0.06
245	0.06
246	0.09
247	0.09
248	0.1
249	0.09
250	0.09
251	0.09
252	0.12
253	0.15
254	0.15
255	0.17
256	0.17
257	0.22
258	0.22
259	0.23
260	0.22
261	0.21
262	0.2
263	0.23
264	0.25
265	0.24
266	0.24
267	0.25
268	0.24
269	0.22
270	0.22
271	0.19
272	0.22
273	0.22
274	0.24
275	0.24
276	0.24
277	0.25
278	0.29
279	0.27
280	0.21
281	0.18
282	0.14
283	0.14
284	0.14
285	0.15
286	0.1
287	0.11
288	0.11
289	0.11
290	0.11
291	0.09
292	0.09
293	0.06
294	0.06
295	0.05
296	0.05
297	0.05
298	0.05
299	0.04
300	0.04
301	0.04
302	0.04
303	0.04
304	0.05
305	0.05
306	0.05
307	0.05
308	0.05
309	0.05
310	0.05
311	0.05
312	0.05
313	0.05
314	0.05
315	0.04
316	0.03
317	0.04
318	0.05
319	0.04
320	0.04
321	0.04
322	0.04
323	0.04
324	0.04
325	0.03
326	0.03
327	0.03
328	0.03
329	0.03
330	0.03
331	0.03
332	0.03
333	0.03
334	0.03
335	0.02
336	0.03
337	0.03
338	0.03
339	0.03
340	0.03
341	0.03
342	0.03
343	0.04
344	0.05
345	0.06
346	0.06
347	0.06
348	0.06
349	0.09
350	0.11
351	0.14
352	0.14
353	0.14
354	0.16
355	0.22
356	0.24
357	0.23
358	0.26
359	0.26
360	0.33
361	0.35
362	0.33
363	0.3
364	0.36
365	0.39
366	0.39
367	0.38
368	0.32
369	0.31
370	0.3
371	0.28
372	0.21
373	0.17
374	0.11
375	0.09
376	0.07
377	0.06
378	0.05
379	0.04
380	0.04
381	0.05
382	0.05
383	0.04
384	0.04
385	0.04
386	0.04
387	0.04
388	0.03
389	0.04
390	0.04
391	0.04
392	0.04
393	0.04
394	0.04
395	0.04
396	0.04
397	0.03
398	0.04
399	0.03
400	0.03
401	0.04
402	0.05
403	0.05
404	0.05
405	0.06
406	0.07
407	0.08
408	0.09
409	0.12
410	0.16
411	0.17
412	0.18
413	0.16
414	0.17
415	0.19
416	0.19
417	0.17
418	0.14
419	0.16
420	0.18
421	0.18
422	0.17
423	0.16
424	0.16
425	0.15
426	0.14
427	0.1
428	0.08
429	0.07
430	0.07
431	0.05
432	0.04
433	0.03
434	0.03
435	0.02
436	0.03
437	0.05
438	0.07
439	0.11
440	0.15
441	0.19
442	0.27
443	0.33
444	0.36
445	0.37
446	0.36
447	0.35
448	0.33
449	0.29
450	0.22
451	0.16
452	0.16
453	0.17
454	0.19
455	0.18
456	0.19
457	0.2
458	0.21
459	0.22
460	0.19
461	0.16
462	0.17
463	0.2
464	0.21
465	0.25
466	0.23
467	0.23
468	0.23
469	0.25
470	0.28
471	0.26
472	0.25
473	0.22
474	0.25
475	0.28
476	0.3
477	0.32
478	0.29
479	0.33
480	0.38
481	0.42
482	0.47
483	0.49
484	0.46
485	0.44
486	0.46
487	0.5
488	0.47
489	0.45
490	0.44
491	0.44
492	0.46
493	0.45
494	0.42
495	0.34
496	0.3
497	0.28
498	0.21
499	0.17
500	0.16
501	0.19
502	0.17
503	0.15
504	0.16
505	0.15
506	0.15
507	0.17
508	0.15
509	0.12
510	0.13
511	0.13
512	0.11
513	0.1
514	0.1
515	0.07
516	0.07
517	0.08
518	0.05
519	0.06
520	0.07
521	0.07
522	0.13
523	0.13
524	0.13
525	0.13
526	0.15
527	0.16
528	0.18
529	0.25
530	0.22
531	0.26
532	0.27
533	0.28
534	0.27
535	0.28
536	0.28
537	0.23
538	0.22
539	0.18
540	0.16
541	0.16
542	0.17
543	0.15
544	0.12
545	0.1
546	0.1
547	0.11
548	0.11
549	0.11
550	0.09
551	0.09
552	0.09
553	0.09
554	0.08
555	0.07
556	0.08
557	0.07
558	0.07
559	0.07
560	0.09
561	0.1
562	0.11
563	0.12
564	0.13
565	0.15
566	0.16
567	0.17
568	0.16
569	0.19
570	0.19
571	0.2
572	0.21
573	0.2
574	0.22
575	0.23
576	0.23
577	0.22
578	0.22
579	0.21
580	0.19
581	0.21
582	0.19
583	0.2
584	0.26
585	0.25
586	0.27
587	0.26
588	0.29
589	0.28
590	0.27
591	0.25
592	0.19
593	0.16
594	0.12
595	0.12
596	0.09
597	0.08
598	0.08
599	0.08
600	0.09
601	0.09
602	0.09
603	0.08
604	0.08
605	0.08
606	0.1
607	0.14
608	0.16
609	0.18
610	0.25
611	0.29
612	0.31
613	0.32
614	0.35
615	0.32
616	0.32
617	0.33
618	0.29
619	0.28
620	0.26
621	0.28
622	0.23
623	0.24
624	0.22
625	0.19
626	0.19
627	0.19
628	0.21
629	0.18
630	0.19
631	0.18
632	0.21
633	0.2
634	0.19
635	0.18
636	0.16
637	0.15
638	0.15
639	0.22
640	0.19
641	0.19
642	0.26
643	0.27
644	0.27
645	0.29
646	0.31
647	0.27
648	0.3
649	0.33
650	0.32
651	0.33
652	0.35
653	0.35
654	0.36
655	0.4
656	0.45
657	0.5
658	0.46
659	0.47
660	0.49
661	0.53
662	0.51
663	0.47
664	0.42
665	0.33
666	0.33
667	0.32
668	0.31
669	0.26
670	0.24
671	0.22
672	0.23
673	0.25
674	0.23
675	0.23
676	0.22
677	0.23
678	0.25
679	0.26
680	0.2
681	0.19
682	0.19
683	0.16
684	0.15
685	0.14
686	0.1
687	0.08
688	0.09
689	0.08
690	0.09
691	0.09
692	0.11
693	0.12
694	0.13
695	0.13
696	0.13
697	0.15
698	0.15
699	0.18
700	0.18
701	0.17
702	0.2
703	0.2
704	0.19
705	0.18
706	0.18
707	0.15
708	0.14
709	0.14
710	0.12
711	0.15
712	0.16
713	0.14
714	0.13
715	0.12
716	0.11
717	0.11
718	0.11
719	0.11
720	0.11
721	0.12
722	0.13
723	0.13
724	0.15
725	0.17
726	0.18
727	0.16
728	0.17
729	0.17
730	0.17
731	0.23
732	0.23
733	0.28
734	0.33
735	0.35
736	0.41
737	0.48
738	0.55
739	0.55

Q6CCF1

3D AlphaFold-predicted Structure Viewer