Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6C5B6

Protein Details
Accession Q6C5B6    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
15-38APQELPSKRAKKQKVNGSDKKDIEHydrophilic
NLS Segment(s)
PositionSequence
20-28PSKRAKKQK
Subcellular Location(s) nucl 19, cyto_nucl 12.333, mito_nucl 11.833, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000866  AhpC/TSA  
IPR036249  Thioredoxin-like_sf  
IPR013766  Thioredoxin_domain  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0008379  F:thioredoxin peroxidase activity  
GO:0045454  P:cell redox homeostasis  
GO:0034599  P:cellular response to oxidative stress  
KEGG yli:YALI0E19448g  -  
Pfam View protein in Pfam  
PF00578  AhpC-TSA  
PROSITE View protein in PROSITE  
PS51352  THIOREDOXIN_2  
CDD cd03017  PRX_BCP  
Amino Acid Sequences MARRSARLAGEKAPAPQELPSKRAKKQKVNGSDKKDIEESKTEESKTEESKTEEDEAKTNESKPEEVPTELQIGDALPEKLTLLDQDSNPIDLSALVAKEPIVVIFAYPKASTPGCTRQVCGFRDKYDDFKKVDATVFGLSADSTAAQKKFQTKQNAPYELLSDPKHELIGILGATKTPGKVPKGVIRSHWIFKNGKLAVKEVKIGPEASYTQALEEVQKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.29
3 0.3
4 0.34
5 0.32
6 0.34
7 0.4
8 0.44
9 0.51
10 0.6
11 0.65
12 0.67
13 0.73
14 0.79
15 0.81
16 0.85
17 0.87
18 0.86
19 0.85
20 0.76
21 0.7
22 0.65
23 0.56
24 0.49
25 0.46
26 0.42
27 0.39
28 0.42
29 0.38
30 0.35
31 0.37
32 0.37
33 0.34
34 0.33
35 0.29
36 0.29
37 0.3
38 0.32
39 0.32
40 0.31
41 0.28
42 0.29
43 0.28
44 0.29
45 0.29
46 0.28
47 0.27
48 0.25
49 0.26
50 0.23
51 0.26
52 0.23
53 0.23
54 0.23
55 0.21
56 0.21
57 0.19
58 0.18
59 0.13
60 0.11
61 0.1
62 0.1
63 0.09
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.07
70 0.08
71 0.1
72 0.1
73 0.14
74 0.14
75 0.15
76 0.14
77 0.14
78 0.11
79 0.08
80 0.09
81 0.06
82 0.06
83 0.05
84 0.05
85 0.05
86 0.05
87 0.05
88 0.04
89 0.04
90 0.04
91 0.04
92 0.05
93 0.06
94 0.06
95 0.07
96 0.07
97 0.08
98 0.09
99 0.11
100 0.14
101 0.2
102 0.27
103 0.27
104 0.28
105 0.32
106 0.38
107 0.37
108 0.39
109 0.34
110 0.28
111 0.34
112 0.34
113 0.36
114 0.36
115 0.39
116 0.35
117 0.34
118 0.34
119 0.3
120 0.29
121 0.22
122 0.18
123 0.14
124 0.12
125 0.11
126 0.09
127 0.08
128 0.07
129 0.07
130 0.05
131 0.05
132 0.09
133 0.09
134 0.1
135 0.13
136 0.2
137 0.26
138 0.33
139 0.42
140 0.44
141 0.53
142 0.62
143 0.64
144 0.58
145 0.53
146 0.48
147 0.39
148 0.38
149 0.29
150 0.22
151 0.2
152 0.19
153 0.18
154 0.15
155 0.14
156 0.11
157 0.11
158 0.09
159 0.08
160 0.08
161 0.07
162 0.09
163 0.09
164 0.09
165 0.11
166 0.17
167 0.19
168 0.23
169 0.28
170 0.36
171 0.41
172 0.43
173 0.43
174 0.46
175 0.48
176 0.5
177 0.49
178 0.47
179 0.44
180 0.44
181 0.5
182 0.45
183 0.44
184 0.4
185 0.4
186 0.41
187 0.41
188 0.43
189 0.35
190 0.35
191 0.33
192 0.32
193 0.29
194 0.26
195 0.25
196 0.24
197 0.25
198 0.21
199 0.19
200 0.2
201 0.2