Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B5RSM5

Protein Details
Accession B5RSM5    Localization Confidence High Confidence Score 17.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MPQAGLKKREKTSKVKKPTGKIAPKRAAPRKBasic
72-95KGNRREIEKKNKEDEEKKKKKAANBasic
NLS Segment(s)
PositionSequence
7-41KKREKTSKVKKPTGKIAPKRAAPRKIAPRRKSAQR
72-99KGNRREIEKKNKEDEEKKKKKAANAQPK
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
KEGG yli:YALI0F30011g  -  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MPQAGLKKREKTSKVKKPTGKIAPKRAAPRKIAPRRKSAQRDVEIAKKHQAALTATTEKLLASRVGHLEILKGNRREIEKKNKEDEEKKKKKAANAQPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.83
3 0.84
4 0.81
5 0.85
6 0.84
7 0.84
8 0.82
9 0.82
10 0.8
11 0.79
12 0.81
13 0.8
14 0.76
15 0.71
16 0.71
17 0.72
18 0.75
19 0.79
20 0.73
21 0.73
22 0.74
23 0.78
24 0.77
25 0.74
26 0.73
27 0.66
28 0.66
29 0.6
30 0.6
31 0.52
32 0.46
33 0.41
34 0.32
35 0.29
36 0.25
37 0.23
38 0.18
39 0.18
40 0.2
41 0.18
42 0.17
43 0.17
44 0.16
45 0.14
46 0.13
47 0.11
48 0.08
49 0.07
50 0.1
51 0.1
52 0.12
53 0.13
54 0.12
55 0.13
56 0.15
57 0.2
58 0.24
59 0.25
60 0.25
61 0.28
62 0.33
63 0.38
64 0.44
65 0.5
66 0.53
67 0.6
68 0.67
69 0.71
70 0.75
71 0.78
72 0.8
73 0.8
74 0.81
75 0.81
76 0.81
77 0.77
78 0.77
79 0.78