Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6CBG3

Protein Details
Accession Q6CBG3   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
130-149VAQYRAEHGKKKKGKKEKKNBasic
NLS Segment(s)
PositionSequence
137-149HGKKKKGKKEKKN
Subcellular Location(s) extr 16, E.R. 6, nucl 2, golg 2
Family & Domain DBs
KEGG yli:YALI0C19107g  -  
Amino Acid Sequences MKFSIIVILACIYLVQAASLFERYVGNKVNYKYSAKVDLFDMSKECNGARIKSINVKPNKYTQCHHLTRINSAFIAPSYDCTVTVWKDRKCRGTPDYNATVNHDDKVCAAHIPEGNSMVISCDDNSNPAVAQYRAEHGKKKKGKKEKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.04
4 0.05
5 0.07
6 0.08
7 0.08
8 0.09
9 0.11
10 0.12
11 0.15
12 0.2
13 0.22
14 0.26
15 0.28
16 0.34
17 0.36
18 0.37
19 0.37
20 0.35
21 0.4
22 0.35
23 0.35
24 0.3
25 0.3
26 0.28
27 0.26
28 0.23
29 0.17
30 0.17
31 0.16
32 0.14
33 0.16
34 0.17
35 0.17
36 0.19
37 0.2
38 0.22
39 0.3
40 0.35
41 0.37
42 0.41
43 0.44
44 0.43
45 0.5
46 0.53
47 0.48
48 0.45
49 0.44
50 0.47
51 0.46
52 0.48
53 0.44
54 0.39
55 0.42
56 0.42
57 0.36
58 0.26
59 0.23
60 0.2
61 0.14
62 0.15
63 0.09
64 0.08
65 0.09
66 0.09
67 0.09
68 0.1
69 0.12
70 0.11
71 0.18
72 0.24
73 0.26
74 0.33
75 0.38
76 0.45
77 0.46
78 0.52
79 0.51
80 0.54
81 0.55
82 0.55
83 0.56
84 0.51
85 0.49
86 0.46
87 0.44
88 0.36
89 0.32
90 0.26
91 0.2
92 0.17
93 0.18
94 0.14
95 0.1
96 0.1
97 0.13
98 0.15
99 0.17
100 0.18
101 0.18
102 0.17
103 0.16
104 0.16
105 0.12
106 0.11
107 0.1
108 0.09
109 0.1
110 0.11
111 0.12
112 0.13
113 0.12
114 0.11
115 0.12
116 0.14
117 0.13
118 0.15
119 0.15
120 0.21
121 0.28
122 0.31
123 0.39
124 0.43
125 0.54
126 0.61
127 0.7
128 0.75
129 0.78