Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6C2H9

Protein Details
Accession Q6C2H9   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
142-194LKDVTKSASKKDKKDKKDKKDKNGSKDKTEEKTQKSAKKDKAKVVKPKKAKKNBasic
NLS Segment(s)
PositionSequence
149-194ASKKDKKDKKDKKDKNGSKDKTEEKTQKSAKKDKAKVVKPKKAKKN
Subcellular Location(s) nucl 13, cyto_nucl 12.333, cyto 10.5, mito_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR011082  Exosome-assoc_fac/DNA_repair  
IPR007146  Sas10/Utp3/C1D  
Gene Ontology GO:0000178  C:exosome (RNase complex)  
GO:0005730  C:nucleolus  
GO:0003677  F:DNA binding  
GO:0003723  F:RNA binding  
GO:0000460  P:maturation of 5.8S rRNA  
GO:0010468  P:regulation of gene expression  
KEGG yli:YALI0F07755g  -  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences MADQIEDVLELSHNLQDVTSELSQQIKMIDFKGVAQLPPLEQAQFYSKLAYVTNSAMFAFILASGGDPKTHPIMKDLDRVKTYMGKVAHAEGKPGPARKDERNTKVDVPAAKRIIFAQTERAISADSIKEPETTSDAAEAFLKDVTKSASKKDKKDKKDKKDKNGSKDKTEEKTQKSAKKDKAKVVKPKKAKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.09
5 0.14
6 0.13
7 0.13
8 0.13
9 0.16
10 0.16
11 0.16
12 0.17
13 0.14
14 0.15
15 0.15
16 0.17
17 0.15
18 0.15
19 0.21
20 0.21
21 0.18
22 0.18
23 0.19
24 0.17
25 0.19
26 0.19
27 0.13
28 0.12
29 0.14
30 0.16
31 0.18
32 0.17
33 0.16
34 0.16
35 0.17
36 0.17
37 0.17
38 0.14
39 0.14
40 0.14
41 0.13
42 0.12
43 0.11
44 0.11
45 0.09
46 0.07
47 0.05
48 0.05
49 0.04
50 0.04
51 0.05
52 0.06
53 0.06
54 0.06
55 0.08
56 0.11
57 0.13
58 0.13
59 0.14
60 0.19
61 0.22
62 0.29
63 0.3
64 0.31
65 0.31
66 0.31
67 0.3
68 0.29
69 0.27
70 0.24
71 0.22
72 0.19
73 0.19
74 0.2
75 0.24
76 0.2
77 0.21
78 0.16
79 0.2
80 0.21
81 0.23
82 0.22
83 0.21
84 0.25
85 0.29
86 0.38
87 0.42
88 0.46
89 0.47
90 0.49
91 0.46
92 0.45
93 0.43
94 0.37
95 0.33
96 0.33
97 0.32
98 0.28
99 0.27
100 0.25
101 0.24
102 0.22
103 0.19
104 0.18
105 0.18
106 0.18
107 0.18
108 0.18
109 0.15
110 0.14
111 0.16
112 0.11
113 0.1
114 0.11
115 0.11
116 0.12
117 0.12
118 0.13
119 0.13
120 0.12
121 0.12
122 0.12
123 0.11
124 0.11
125 0.12
126 0.11
127 0.09
128 0.09
129 0.09
130 0.08
131 0.08
132 0.11
133 0.16
134 0.17
135 0.24
136 0.34
137 0.41
138 0.5
139 0.6
140 0.68
141 0.72
142 0.83
143 0.86
144 0.87
145 0.92
146 0.92
147 0.92
148 0.94
149 0.93
150 0.92
151 0.92
152 0.87
153 0.83
154 0.82
155 0.79
156 0.73
157 0.74
158 0.73
159 0.68
160 0.72
161 0.72
162 0.71
163 0.72
164 0.76
165 0.76
166 0.78
167 0.8
168 0.8
169 0.82
170 0.84
171 0.86
172 0.88
173 0.88
174 0.88