Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6C502

Protein Details
Accession Q6C502    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
173-197IIEPIEEKPKKKKRKKNNVFVEDVPHydrophilic
NLS Segment(s)
PositionSequence
180-188KPKKKKRKK
Subcellular Location(s) cyto 17, cyto_nucl 13, nucl 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011992  EF-hand-dom_pair  
KEGG yli:YALI0E22242g  -  
Amino Acid Sequences MDWTKSFTISSAKPGRPVRLSGVEKTALQAAFDEHAEDGVISAFDVPLVIMDLGWSVEEFSGTDNLDECVNILKPHFLNDVITFDDFSDGFSRMITRQVLDPGFVSEGEGSGDDQGGFLAEEIADIEDDASSEGGGGFVASDEDEGGGFVASEEEGDEGGGFFVASDGGTGGIIEPIEEKPKKKKRKKNNVFVEDVPLAFSWFTKSDTINTADLRRIAKLVKDNASEKDFKDMMEVAGAVGGKIDIQAFEGLLKKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.55
3 0.52
4 0.54
5 0.51
6 0.52
7 0.54
8 0.49
9 0.49
10 0.44
11 0.41
12 0.39
13 0.37
14 0.26
15 0.22
16 0.19
17 0.16
18 0.15
19 0.15
20 0.15
21 0.1
22 0.1
23 0.09
24 0.09
25 0.07
26 0.06
27 0.06
28 0.04
29 0.05
30 0.04
31 0.04
32 0.04
33 0.04
34 0.03
35 0.05
36 0.05
37 0.04
38 0.04
39 0.05
40 0.05
41 0.05
42 0.05
43 0.04
44 0.04
45 0.05
46 0.05
47 0.06
48 0.08
49 0.08
50 0.08
51 0.08
52 0.09
53 0.09
54 0.08
55 0.07
56 0.08
57 0.09
58 0.09
59 0.09
60 0.12
61 0.12
62 0.16
63 0.17
64 0.15
65 0.16
66 0.16
67 0.18
68 0.16
69 0.16
70 0.13
71 0.12
72 0.13
73 0.1
74 0.1
75 0.1
76 0.09
77 0.09
78 0.09
79 0.1
80 0.09
81 0.13
82 0.12
83 0.11
84 0.12
85 0.16
86 0.16
87 0.15
88 0.15
89 0.12
90 0.13
91 0.12
92 0.11
93 0.07
94 0.06
95 0.06
96 0.06
97 0.05
98 0.05
99 0.05
100 0.04
101 0.04
102 0.04
103 0.04
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.02
124 0.02
125 0.02
126 0.02
127 0.02
128 0.02
129 0.02
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.03
145 0.03
146 0.03
147 0.03
148 0.03
149 0.02
150 0.03
151 0.03
152 0.03
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.03
159 0.04
160 0.04
161 0.04
162 0.05
163 0.06
164 0.13
165 0.16
166 0.19
167 0.29
168 0.4
169 0.51
170 0.6
171 0.7
172 0.74
173 0.84
174 0.92
175 0.92
176 0.93
177 0.9
178 0.85
179 0.76
180 0.71
181 0.6
182 0.49
183 0.39
184 0.28
185 0.21
186 0.15
187 0.14
188 0.1
189 0.1
190 0.13
191 0.13
192 0.14
193 0.16
194 0.2
195 0.24
196 0.24
197 0.25
198 0.25
199 0.26
200 0.29
201 0.28
202 0.25
203 0.23
204 0.22
205 0.25
206 0.31
207 0.35
208 0.38
209 0.42
210 0.44
211 0.47
212 0.5
213 0.48
214 0.41
215 0.42
216 0.35
217 0.3
218 0.31
219 0.27
220 0.22
221 0.21
222 0.2
223 0.12
224 0.13
225 0.13
226 0.09
227 0.08
228 0.07
229 0.06
230 0.06
231 0.07
232 0.05
233 0.07
234 0.08
235 0.08
236 0.1