Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6CES0

Protein Details
Accession Q6CES0    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGYSRRRPRKAWVEKTPRELVEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012942  SRR1-like  
IPR040044  SRR1L  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0007017  P:microtubule-based process  
KEGG yli:YALI0B13486g  -  
Pfam View protein in Pfam  
PF07985  SRR1  
Amino Acid Sequences MGYSRRRPRKAWVEKTPRELVEGLEELKRDVKRSKFYDFFQTHLQQTLEKHSTKEFADIQCLALGKPAEDEGVRYQLVLLLLLAEELKIPLDKVVCTEPMFTARDEEMLKLLGMKTVTGMWDPDFRTKDVEEETKSVKSDTQKADMEDTTDIAAESGDIEDLTKSISEVKLQPTESFIYAPHAPVNVNELLFINADFIVANYLGSYDTRFGDDEFKQKYPALSTILQSEKDLKCEWEMIEIPDKLSKGEAWAVAYNGFGIHRKERKAAAAEEREEKEKTLKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.87
3 0.83
4 0.72
5 0.65
6 0.55
7 0.45
8 0.39
9 0.34
10 0.28
11 0.23
12 0.23
13 0.21
14 0.26
15 0.26
16 0.25
17 0.3
18 0.36
19 0.43
20 0.47
21 0.55
22 0.55
23 0.56
24 0.63
25 0.57
26 0.53
27 0.52
28 0.51
29 0.43
30 0.42
31 0.4
32 0.31
33 0.32
34 0.37
35 0.35
36 0.32
37 0.32
38 0.3
39 0.33
40 0.31
41 0.34
42 0.31
43 0.26
44 0.3
45 0.29
46 0.27
47 0.25
48 0.25
49 0.19
50 0.17
51 0.16
52 0.11
53 0.12
54 0.11
55 0.1
56 0.1
57 0.13
58 0.12
59 0.15
60 0.14
61 0.14
62 0.13
63 0.14
64 0.14
65 0.11
66 0.09
67 0.05
68 0.05
69 0.06
70 0.06
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.06
78 0.07
79 0.07
80 0.09
81 0.11
82 0.13
83 0.13
84 0.14
85 0.13
86 0.16
87 0.17
88 0.16
89 0.16
90 0.14
91 0.16
92 0.15
93 0.15
94 0.12
95 0.11
96 0.11
97 0.09
98 0.09
99 0.08
100 0.08
101 0.07
102 0.07
103 0.07
104 0.08
105 0.07
106 0.08
107 0.07
108 0.11
109 0.13
110 0.18
111 0.19
112 0.19
113 0.21
114 0.2
115 0.21
116 0.2
117 0.22
118 0.18
119 0.19
120 0.21
121 0.2
122 0.2
123 0.19
124 0.18
125 0.18
126 0.23
127 0.23
128 0.26
129 0.26
130 0.27
131 0.29
132 0.26
133 0.25
134 0.18
135 0.16
136 0.11
137 0.09
138 0.08
139 0.06
140 0.05
141 0.04
142 0.04
143 0.03
144 0.03
145 0.03
146 0.03
147 0.03
148 0.03
149 0.04
150 0.03
151 0.04
152 0.06
153 0.06
154 0.08
155 0.11
156 0.14
157 0.18
158 0.19
159 0.19
160 0.2
161 0.21
162 0.19
163 0.17
164 0.14
165 0.14
166 0.14
167 0.15
168 0.13
169 0.12
170 0.12
171 0.11
172 0.15
173 0.12
174 0.11
175 0.11
176 0.11
177 0.11
178 0.11
179 0.11
180 0.08
181 0.06
182 0.06
183 0.06
184 0.05
185 0.06
186 0.05
187 0.05
188 0.04
189 0.05
190 0.05
191 0.06
192 0.07
193 0.07
194 0.08
195 0.09
196 0.1
197 0.11
198 0.16
199 0.18
200 0.24
201 0.27
202 0.28
203 0.29
204 0.29
205 0.3
206 0.27
207 0.28
208 0.25
209 0.23
210 0.23
211 0.27
212 0.29
213 0.28
214 0.26
215 0.32
216 0.28
217 0.29
218 0.29
219 0.24
220 0.23
221 0.25
222 0.24
223 0.22
224 0.23
225 0.23
226 0.29
227 0.27
228 0.27
229 0.27
230 0.27
231 0.22
232 0.22
233 0.19
234 0.15
235 0.18
236 0.18
237 0.18
238 0.2
239 0.2
240 0.19
241 0.19
242 0.16
243 0.13
244 0.13
245 0.13
246 0.16
247 0.24
248 0.31
249 0.34
250 0.39
251 0.42
252 0.48
253 0.51
254 0.53
255 0.54
256 0.56
257 0.56
258 0.59
259 0.59
260 0.56
261 0.51
262 0.46