Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6C0Y4

Protein Details
Accession Q6C0Y4    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
29-48AKPLAPKKLNKKVLKTVKKAHydrophilic
NLS Segment(s)
PositionSequence
31-69PLAPKKLNKKVLKTVKKASKAKHVKRGVKEVVKALRKGE
Subcellular Location(s) cyto 20.5, cyto_nucl 12.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002415  H/ACA_rnp_Nhp2-like  
IPR029064  L30e-like  
IPR004038  Ribosomal_L7Ae/L30e/S12e/Gad45  
IPR018492  Ribosomal_L7Ae/L8/Nhp2  
IPR004037  Ribosomal_L7Ae_CS  
Gene Ontology GO:0031429  C:box H/ACA snoRNP complex  
GO:0034513  F:box H/ACA snoRNA binding  
GO:0000493  P:box H/ACA snoRNP assembly  
GO:0000469  P:cleavage involved in rRNA processing  
GO:0031118  P:rRNA pseudouridine synthesis  
GO:0000454  P:snoRNA guided rRNA pseudouridine synthesis  
GO:0031120  P:snRNA pseudouridine synthesis  
KEGG yli:YALI0F20768g  -  
Pfam View protein in Pfam  
PF01248  Ribosomal_L7Ae  
PROSITE View protein in PROSITE  
PS01082  RIBOSOMAL_L7AE  
Amino Acid Sequences MGKDKGDITVEIDEVDNYDARMEALLPFAKPLAPKKLNKKVLKTVKKASKAKHVKRGVKEVVKALRKGEKGLVIIAGDISPMDVVSHIPVLCEDNGVPYLFIPSKEDLGAAGATKRPTSTVMIVPGGGKSKKADTKVEYKENFDEIVKDVKKLED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.11
4 0.08
5 0.08
6 0.08
7 0.07
8 0.08
9 0.07
10 0.06
11 0.1
12 0.11
13 0.1
14 0.11
15 0.11
16 0.13
17 0.15
18 0.2
19 0.27
20 0.33
21 0.4
22 0.5
23 0.6
24 0.68
25 0.72
26 0.75
27 0.75
28 0.79
29 0.81
30 0.78
31 0.77
32 0.76
33 0.79
34 0.78
35 0.72
36 0.72
37 0.73
38 0.75
39 0.75
40 0.75
41 0.74
42 0.73
43 0.77
44 0.74
45 0.68
46 0.62
47 0.58
48 0.56
49 0.52
50 0.48
51 0.42
52 0.4
53 0.36
54 0.35
55 0.31
56 0.25
57 0.22
58 0.21
59 0.19
60 0.12
61 0.11
62 0.1
63 0.08
64 0.05
65 0.04
66 0.03
67 0.02
68 0.02
69 0.02
70 0.02
71 0.03
72 0.03
73 0.05
74 0.05
75 0.05
76 0.06
77 0.07
78 0.07
79 0.08
80 0.07
81 0.07
82 0.08
83 0.08
84 0.08
85 0.06
86 0.09
87 0.1
88 0.1
89 0.11
90 0.12
91 0.13
92 0.13
93 0.13
94 0.1
95 0.1
96 0.1
97 0.08
98 0.09
99 0.1
100 0.11
101 0.11
102 0.11
103 0.11
104 0.13
105 0.16
106 0.18
107 0.19
108 0.21
109 0.22
110 0.22
111 0.21
112 0.21
113 0.23
114 0.2
115 0.18
116 0.17
117 0.24
118 0.29
119 0.33
120 0.39
121 0.39
122 0.49
123 0.56
124 0.63
125 0.58
126 0.58
127 0.57
128 0.52
129 0.48
130 0.39
131 0.32
132 0.25
133 0.32
134 0.28
135 0.26