Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6C9N9

Protein Details
Accession Q6C9N9    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
111-150LSKTYNQEKEKEKKKKEKEEKKEKKRKEKEEKKKIKEEEKBasic
NLS Segment(s)
PositionSequence
119-150KEKEKKKKEKEEKKEKKRKEKEEKKKIKEEEK
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR003195  TFIID_TAF13  
Gene Ontology GO:0005669  C:transcription factor TFIID complex  
GO:0046982  F:protein heterodimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
GO:0051123  P:RNA polymerase II preinitiation complex assembly  
GO:0006366  P:transcription by RNA polymerase II  
KEGG yli:YALI0D09625g  -  
Pfam View protein in Pfam  
PF02269  TFIID-18kDa  
CDD cd07978  TAF13  
Amino Acid Sequences MSLEGTRKRKRTNLFVNDIKPLLYAFGDVNDPYPETVAALEDILTDYIVDTCHEAAKMAEIAGRQKIKVDDFKFLLRNDPRKLGRAEELLVLQKEFVEARKAFDSTEGKQLSKTYNQEKEKEKKKKEKEEKKEKKRKEKEEKKKIKEEEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.77
3 0.73
4 0.7
5 0.62
6 0.51
7 0.4
8 0.3
9 0.23
10 0.15
11 0.13
12 0.08
13 0.09
14 0.11
15 0.1
16 0.12
17 0.11
18 0.12
19 0.11
20 0.11
21 0.1
22 0.08
23 0.08
24 0.07
25 0.07
26 0.06
27 0.06
28 0.05
29 0.06
30 0.06
31 0.05
32 0.04
33 0.04
34 0.05
35 0.05
36 0.05
37 0.05
38 0.06
39 0.07
40 0.07
41 0.07
42 0.06
43 0.08
44 0.08
45 0.07
46 0.08
47 0.07
48 0.09
49 0.14
50 0.15
51 0.13
52 0.15
53 0.16
54 0.18
55 0.25
56 0.25
57 0.24
58 0.25
59 0.29
60 0.3
61 0.28
62 0.33
63 0.3
64 0.35
65 0.33
66 0.38
67 0.37
68 0.37
69 0.38
70 0.33
71 0.31
72 0.27
73 0.26
74 0.2
75 0.2
76 0.19
77 0.18
78 0.15
79 0.12
80 0.1
81 0.09
82 0.09
83 0.08
84 0.12
85 0.12
86 0.15
87 0.18
88 0.18
89 0.17
90 0.23
91 0.26
92 0.22
93 0.31
94 0.29
95 0.28
96 0.29
97 0.31
98 0.29
99 0.31
100 0.36
101 0.36
102 0.43
103 0.48
104 0.54
105 0.61
106 0.67
107 0.71
108 0.75
109 0.77
110 0.78
111 0.84
112 0.89
113 0.91
114 0.93
115 0.93
116 0.94
117 0.95
118 0.96
119 0.96
120 0.95
121 0.95
122 0.95
123 0.95
124 0.95
125 0.95
126 0.95
127 0.95
128 0.96
129 0.94
130 0.94