Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074RX81

Protein Details
Accession A0A074RX81    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
167-198YQPPVVKKQSRGTRKRSRRRAKKTADPAETNPHydrophilic
NLS Segment(s)
PositionSequence
173-189KKQSRGTRKRSRRRAKK
Subcellular Location(s) nucl 15, cyto_nucl 12.833, cyto 9.5, mito_nucl 9.333
Family & Domain DBs
Amino Acid Sequences MDPSPATDDTSPHCMRIASHGKISLLVAFALKFLKENPKRPLVLHTLPYKPGADAEEPDAPEPDAKKRKIEPSTTNVARLISVAEIVKREFKEGSLHQYNEIGCLDEPKSPEGAGIGVPSEPGAERQAALQKVVEGKNHLPIKRTPYMKITLSQSQLPESQVPNSTYQPPVVKKQSRGTRKRSRRRAKKTADPAETNPAETTEDDVEEDAMDIVAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.32
4 0.36
5 0.31
6 0.34
7 0.36
8 0.35
9 0.36
10 0.36
11 0.27
12 0.19
13 0.16
14 0.12
15 0.1
16 0.11
17 0.1
18 0.1
19 0.09
20 0.11
21 0.22
22 0.29
23 0.37
24 0.42
25 0.49
26 0.5
27 0.51
28 0.55
29 0.52
30 0.5
31 0.48
32 0.48
33 0.44
34 0.44
35 0.44
36 0.38
37 0.3
38 0.26
39 0.23
40 0.19
41 0.17
42 0.19
43 0.21
44 0.21
45 0.21
46 0.2
47 0.17
48 0.18
49 0.18
50 0.23
51 0.28
52 0.29
53 0.33
54 0.38
55 0.47
56 0.51
57 0.57
58 0.54
59 0.51
60 0.59
61 0.55
62 0.52
63 0.44
64 0.37
65 0.3
66 0.24
67 0.19
68 0.09
69 0.09
70 0.07
71 0.07
72 0.08
73 0.09
74 0.13
75 0.12
76 0.14
77 0.13
78 0.13
79 0.18
80 0.18
81 0.26
82 0.27
83 0.27
84 0.26
85 0.28
86 0.27
87 0.24
88 0.22
89 0.15
90 0.09
91 0.11
92 0.11
93 0.11
94 0.12
95 0.11
96 0.11
97 0.1
98 0.1
99 0.08
100 0.08
101 0.06
102 0.05
103 0.05
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.05
110 0.06
111 0.06
112 0.06
113 0.08
114 0.13
115 0.13
116 0.14
117 0.13
118 0.13
119 0.17
120 0.19
121 0.19
122 0.17
123 0.18
124 0.26
125 0.31
126 0.31
127 0.29
128 0.31
129 0.37
130 0.41
131 0.42
132 0.36
133 0.36
134 0.4
135 0.39
136 0.39
137 0.37
138 0.35
139 0.35
140 0.35
141 0.32
142 0.29
143 0.29
144 0.27
145 0.25
146 0.21
147 0.21
148 0.22
149 0.23
150 0.24
151 0.25
152 0.27
153 0.25
154 0.27
155 0.3
156 0.3
157 0.36
158 0.43
159 0.47
160 0.49
161 0.58
162 0.64
163 0.69
164 0.74
165 0.77
166 0.78
167 0.83
168 0.88
169 0.9
170 0.92
171 0.92
172 0.94
173 0.95
174 0.93
175 0.93
176 0.93
177 0.92
178 0.89
179 0.83
180 0.77
181 0.75
182 0.66
183 0.57
184 0.46
185 0.37
186 0.31
187 0.25
188 0.25
189 0.17
190 0.17
191 0.15
192 0.15
193 0.14
194 0.12
195 0.12
196 0.09