Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F2Z6B8

Protein Details
Accession F2Z6B8    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
26-49KTEHKVVKARTPKKMKPGMARFRIBasic
NLS Segment(s)
PositionSequence
33-42KARTPKKMKP
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 2
Family & Domain DBs
KEGG yli:YALI0C07480g  -  
Amino Acid Sequences MRQDEYHIKQRIFSISKAAITMIKIKTEHKVVKARTPKKMKPGMARFRIQAVPIINQNNNAYLSEISFEEKLEPVPPMYPELQKVLDYIHSRKVPFDGSSGPYPPSSRRQVVNGYVAFKLYHHVPHTDLSAIDITHLLQGPWRACPDRHIWTKYADHYRSRGRDVAFKTWLLSVTSPAPEKGLIIQPQTQSEQGYNFSSSSDFSSSPEHSETLPVSSGEPSTPVDPFLIEFDQGIAEKEASFTSPCNQNYDLDFSQLQPLSIRVPYFNQYASSSNSGLDVDYFDGSTLDTPSYIDTFITPLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.38
3 0.39
4 0.37
5 0.34
6 0.26
7 0.25
8 0.31
9 0.25
10 0.26
11 0.26
12 0.28
13 0.32
14 0.39
15 0.43
16 0.43
17 0.5
18 0.5
19 0.58
20 0.67
21 0.7
22 0.71
23 0.76
24 0.75
25 0.76
26 0.81
27 0.79
28 0.79
29 0.82
30 0.82
31 0.79
32 0.77
33 0.68
34 0.64
35 0.58
36 0.48
37 0.42
38 0.34
39 0.3
40 0.31
41 0.35
42 0.3
43 0.31
44 0.31
45 0.29
46 0.27
47 0.24
48 0.2
49 0.15
50 0.15
51 0.13
52 0.12
53 0.12
54 0.11
55 0.11
56 0.11
57 0.11
58 0.11
59 0.11
60 0.12
61 0.1
62 0.12
63 0.12
64 0.14
65 0.17
66 0.18
67 0.18
68 0.21
69 0.21
70 0.2
71 0.19
72 0.17
73 0.2
74 0.22
75 0.23
76 0.27
77 0.29
78 0.29
79 0.3
80 0.31
81 0.27
82 0.24
83 0.24
84 0.2
85 0.21
86 0.23
87 0.24
88 0.23
89 0.21
90 0.22
91 0.23
92 0.26
93 0.29
94 0.29
95 0.3
96 0.32
97 0.36
98 0.38
99 0.41
100 0.36
101 0.32
102 0.29
103 0.28
104 0.24
105 0.19
106 0.17
107 0.12
108 0.14
109 0.13
110 0.14
111 0.15
112 0.16
113 0.17
114 0.16
115 0.14
116 0.12
117 0.11
118 0.1
119 0.09
120 0.08
121 0.07
122 0.07
123 0.08
124 0.06
125 0.06
126 0.09
127 0.1
128 0.11
129 0.13
130 0.13
131 0.13
132 0.17
133 0.21
134 0.26
135 0.32
136 0.33
137 0.32
138 0.34
139 0.37
140 0.4
141 0.43
142 0.39
143 0.35
144 0.37
145 0.42
146 0.41
147 0.41
148 0.39
149 0.32
150 0.35
151 0.37
152 0.38
153 0.33
154 0.31
155 0.28
156 0.25
157 0.25
158 0.19
159 0.16
160 0.12
161 0.12
162 0.13
163 0.13
164 0.12
165 0.12
166 0.11
167 0.11
168 0.11
169 0.14
170 0.15
171 0.16
172 0.2
173 0.2
174 0.22
175 0.24
176 0.22
177 0.18
178 0.17
179 0.16
180 0.15
181 0.15
182 0.14
183 0.13
184 0.13
185 0.12
186 0.12
187 0.13
188 0.13
189 0.12
190 0.12
191 0.16
192 0.16
193 0.18
194 0.19
195 0.18
196 0.15
197 0.17
198 0.17
199 0.14
200 0.14
201 0.12
202 0.12
203 0.12
204 0.12
205 0.1
206 0.11
207 0.11
208 0.11
209 0.11
210 0.11
211 0.1
212 0.1
213 0.1
214 0.12
215 0.11
216 0.1
217 0.1
218 0.09
219 0.1
220 0.1
221 0.11
222 0.09
223 0.08
224 0.08
225 0.09
226 0.09
227 0.09
228 0.1
229 0.1
230 0.14
231 0.22
232 0.23
233 0.27
234 0.28
235 0.29
236 0.3
237 0.37
238 0.32
239 0.28
240 0.28
241 0.24
242 0.29
243 0.27
244 0.25
245 0.18
246 0.19
247 0.18
248 0.2
249 0.2
250 0.15
251 0.18
252 0.22
253 0.23
254 0.24
255 0.23
256 0.23
257 0.25
258 0.28
259 0.29
260 0.26
261 0.23
262 0.23
263 0.21
264 0.18
265 0.16
266 0.13
267 0.11
268 0.11
269 0.11
270 0.1
271 0.1
272 0.1
273 0.1
274 0.1
275 0.09
276 0.08
277 0.09
278 0.11
279 0.12
280 0.12
281 0.11
282 0.1