Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074S1W5

Protein Details
Accession A0A074S1W5   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
127-152VALPETPRPRPKPKPKPKPRSAALVSHydrophilic
NLS Segment(s)
PositionSequence
133-146PRPRPKPKPKPKPR
Subcellular Location(s) nucl 18.5, cyto_nucl 14, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
IPR006640  SprT-like_domain  
Gene Ontology GO:0051716  P:cellular response to stimulus  
Pfam View protein in Pfam  
PF10263  SprT-like  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MNRPNETGSTDSELDETKLFDPDVSHPGILLFNPGPRKPAFIAHRSGTSISTPGTSDYSQDLCGDGGTRSNIQSGSPSEGYLSDSYEDVEEIKTPAESPKPSANGKTKANSSGSGYLNRFRADINEVALPETPRPRPKPKPKPKPRSAALVSASASASTLPLSPKPTLRNQAKVLQATAIALFEELNNSVFHGKLPKDCPIEWSKKLNTTAGRAHWKRVRDANGNVTRHDTRIELSTKVVDCEERVRNTLSHEMCHLGAWVFDSEMKPPHGPAFKRWSDRIMKARPDITISTCHSYEISYKFEWKCSSEQCGRTYGRHSKSIDPEKQVCGACRSKLTPQFETAPKRTAFQDYLKTHMKDFKAANPGIKHGDAMRRLGEMFRAEKEATVDEELDQVMSGMTRLGIDSHAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.2
4 0.15
5 0.16
6 0.16
7 0.15
8 0.17
9 0.19
10 0.23
11 0.24
12 0.22
13 0.2
14 0.21
15 0.22
16 0.19
17 0.2
18 0.16
19 0.19
20 0.25
21 0.26
22 0.29
23 0.28
24 0.33
25 0.3
26 0.38
27 0.4
28 0.4
29 0.46
30 0.45
31 0.48
32 0.45
33 0.44
34 0.37
35 0.31
36 0.27
37 0.21
38 0.19
39 0.16
40 0.15
41 0.18
42 0.16
43 0.16
44 0.18
45 0.19
46 0.19
47 0.18
48 0.17
49 0.14
50 0.14
51 0.13
52 0.1
53 0.11
54 0.13
55 0.14
56 0.14
57 0.16
58 0.16
59 0.15
60 0.19
61 0.18
62 0.22
63 0.21
64 0.21
65 0.19
66 0.19
67 0.22
68 0.19
69 0.18
70 0.12
71 0.11
72 0.12
73 0.11
74 0.11
75 0.09
76 0.09
77 0.08
78 0.08
79 0.09
80 0.08
81 0.09
82 0.12
83 0.17
84 0.18
85 0.21
86 0.27
87 0.31
88 0.34
89 0.41
90 0.45
91 0.46
92 0.5
93 0.51
94 0.48
95 0.48
96 0.48
97 0.42
98 0.38
99 0.38
100 0.35
101 0.36
102 0.35
103 0.34
104 0.34
105 0.33
106 0.29
107 0.22
108 0.23
109 0.2
110 0.2
111 0.18
112 0.17
113 0.17
114 0.17
115 0.19
116 0.17
117 0.16
118 0.19
119 0.22
120 0.28
121 0.35
122 0.43
123 0.53
124 0.63
125 0.72
126 0.79
127 0.85
128 0.89
129 0.93
130 0.93
131 0.92
132 0.84
133 0.82
134 0.74
135 0.7
136 0.6
137 0.52
138 0.44
139 0.35
140 0.31
141 0.21
142 0.18
143 0.1
144 0.08
145 0.06
146 0.07
147 0.07
148 0.09
149 0.12
150 0.14
151 0.17
152 0.21
153 0.27
154 0.35
155 0.38
156 0.43
157 0.43
158 0.48
159 0.49
160 0.46
161 0.4
162 0.31
163 0.27
164 0.21
165 0.17
166 0.11
167 0.06
168 0.05
169 0.05
170 0.04
171 0.05
172 0.05
173 0.05
174 0.05
175 0.06
176 0.06
177 0.06
178 0.07
179 0.1
180 0.11
181 0.15
182 0.18
183 0.23
184 0.26
185 0.26
186 0.3
187 0.33
188 0.38
189 0.37
190 0.4
191 0.36
192 0.38
193 0.39
194 0.39
195 0.34
196 0.32
197 0.32
198 0.31
199 0.39
200 0.35
201 0.4
202 0.4
203 0.4
204 0.4
205 0.42
206 0.44
207 0.4
208 0.43
209 0.47
210 0.51
211 0.5
212 0.46
213 0.45
214 0.39
215 0.33
216 0.31
217 0.21
218 0.14
219 0.18
220 0.19
221 0.16
222 0.15
223 0.18
224 0.18
225 0.18
226 0.17
227 0.13
228 0.12
229 0.18
230 0.22
231 0.2
232 0.21
233 0.22
234 0.22
235 0.25
236 0.32
237 0.26
238 0.22
239 0.22
240 0.21
241 0.2
242 0.19
243 0.17
244 0.09
245 0.08
246 0.09
247 0.08
248 0.06
249 0.08
250 0.08
251 0.09
252 0.12
253 0.14
254 0.14
255 0.14
256 0.19
257 0.24
258 0.25
259 0.3
260 0.36
261 0.4
262 0.45
263 0.46
264 0.48
265 0.48
266 0.54
267 0.57
268 0.55
269 0.55
270 0.54
271 0.54
272 0.48
273 0.45
274 0.4
275 0.33
276 0.31
277 0.28
278 0.28
279 0.26
280 0.26
281 0.23
282 0.22
283 0.24
284 0.22
285 0.23
286 0.2
287 0.27
288 0.28
289 0.32
290 0.33
291 0.31
292 0.34
293 0.33
294 0.4
295 0.41
296 0.45
297 0.43
298 0.48
299 0.47
300 0.45
301 0.49
302 0.51
303 0.47
304 0.5
305 0.51
306 0.51
307 0.59
308 0.66
309 0.64
310 0.62
311 0.62
312 0.57
313 0.6
314 0.54
315 0.46
316 0.43
317 0.41
318 0.36
319 0.37
320 0.37
321 0.4
322 0.46
323 0.5
324 0.46
325 0.46
326 0.51
327 0.53
328 0.59
329 0.54
330 0.53
331 0.47
332 0.46
333 0.45
334 0.44
335 0.41
336 0.38
337 0.45
338 0.4
339 0.46
340 0.52
341 0.5
342 0.47
343 0.5
344 0.45
345 0.42
346 0.43
347 0.43
348 0.45
349 0.46
350 0.49
351 0.44
352 0.47
353 0.45
354 0.42
355 0.36
356 0.32
357 0.38
358 0.34
359 0.35
360 0.32
361 0.29
362 0.3
363 0.3
364 0.29
365 0.26
366 0.26
367 0.25
368 0.28
369 0.26
370 0.27
371 0.29
372 0.26
373 0.25
374 0.24
375 0.22
376 0.18
377 0.19
378 0.18
379 0.15
380 0.13
381 0.1
382 0.08
383 0.07
384 0.06
385 0.05
386 0.05
387 0.06
388 0.06
389 0.07