Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074S136

Protein Details
Accession A0A074S136   
Localization Confidence High
Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
414-450ASKGVDQKERKSHRRVPKGKKRVMKTRRVKNAKGYMVBasic
NLS Segment(s)
PositionSequence
230-249APGSKLKETLPEKPKEKKVP
329-335AIKRKKS
414-445ASKGVDQKERKSHRRVPKGKKRVMKTRRVKNA
520-521KK
Subcellular Location(s) nucl 19.5, cyto_nucl 11.833, mito 4.5, cyto_mito 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR019038  POLD3  
IPR041913  POLD3_sf  
Gene Ontology GO:0043625  C:delta DNA polymerase complex  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF09507  CDC27  
Amino Acid Sequences MASKAVTDFLTKEVKVSNNIVTFRLLSRQLSIHVAEAKRRVIVNHQLLGYSAYTFRELELYYEEAKRNKTPVFATYILTGAATPQPQDGSSEQISRHLIVLANEEEIDAAKSKFTDTPSQHVYSLSPVSLKDHGLLTSVADRVRQLDKQKGQAHAARVGMLLSEQAPWPQPASGKPKPSNIVPKKDTPTVTAKKSEPAIKPKVLDSDTPPPATKDAARQSALDFGSKKSAPGSKLKETLPEKPKEKKVPTTKPTVPDKIADKEPASRKTTSQAERPKEVTKPPSTDSNKGNAVDSAKPIAASLRNTGARSKRILDSDEDEPAQNHPRPAIKRKKSRIAAEDNGEAEPVNEHNTASLQAMMDIDDGESVLKSGSFPTNLFIDTVVNGRSNREATPEHVPSAREVAAAAKAAKIEASKGVDQKERKSHRRVPKGKKRVMKTRRVKNAKGYMVTEDYSSYEDADPNDTEKSEDTDVKSETDYGDDIDVDVSGQVVSTKPSKPTALTSQPKRQQSNSLPSAKPKKGKTSDSSKPGQQKLASFFGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.34
4 0.37
5 0.37
6 0.38
7 0.38
8 0.35
9 0.33
10 0.3
11 0.32
12 0.29
13 0.24
14 0.26
15 0.26
16 0.27
17 0.29
18 0.28
19 0.26
20 0.31
21 0.31
22 0.34
23 0.37
24 0.36
25 0.36
26 0.36
27 0.34
28 0.34
29 0.42
30 0.44
31 0.44
32 0.42
33 0.39
34 0.38
35 0.39
36 0.31
37 0.23
38 0.17
39 0.13
40 0.14
41 0.14
42 0.14
43 0.15
44 0.14
45 0.15
46 0.16
47 0.18
48 0.2
49 0.24
50 0.28
51 0.29
52 0.33
53 0.35
54 0.37
55 0.36
56 0.37
57 0.36
58 0.35
59 0.38
60 0.36
61 0.34
62 0.3
63 0.28
64 0.24
65 0.21
66 0.17
67 0.11
68 0.13
69 0.12
70 0.11
71 0.12
72 0.13
73 0.13
74 0.16
75 0.16
76 0.18
77 0.2
78 0.23
79 0.22
80 0.26
81 0.27
82 0.25
83 0.24
84 0.2
85 0.19
86 0.17
87 0.21
88 0.17
89 0.17
90 0.16
91 0.15
92 0.13
93 0.12
94 0.12
95 0.09
96 0.08
97 0.08
98 0.08
99 0.11
100 0.14
101 0.17
102 0.25
103 0.26
104 0.33
105 0.38
106 0.4
107 0.39
108 0.37
109 0.34
110 0.29
111 0.27
112 0.21
113 0.16
114 0.14
115 0.17
116 0.18
117 0.18
118 0.15
119 0.15
120 0.14
121 0.15
122 0.15
123 0.13
124 0.13
125 0.15
126 0.13
127 0.13
128 0.13
129 0.15
130 0.18
131 0.22
132 0.24
133 0.32
134 0.36
135 0.45
136 0.5
137 0.5
138 0.52
139 0.52
140 0.5
141 0.45
142 0.41
143 0.32
144 0.27
145 0.23
146 0.18
147 0.13
148 0.1
149 0.06
150 0.07
151 0.06
152 0.07
153 0.08
154 0.09
155 0.1
156 0.11
157 0.12
158 0.17
159 0.26
160 0.31
161 0.39
162 0.42
163 0.46
164 0.48
165 0.52
166 0.57
167 0.56
168 0.6
169 0.55
170 0.59
171 0.58
172 0.6
173 0.55
174 0.48
175 0.5
176 0.47
177 0.47
178 0.44
179 0.41
180 0.39
181 0.42
182 0.45
183 0.41
184 0.44
185 0.46
186 0.44
187 0.44
188 0.42
189 0.44
190 0.38
191 0.34
192 0.31
193 0.33
194 0.33
195 0.34
196 0.32
197 0.28
198 0.27
199 0.27
200 0.23
201 0.21
202 0.24
203 0.27
204 0.28
205 0.27
206 0.27
207 0.31
208 0.3
209 0.25
210 0.2
211 0.16
212 0.21
213 0.2
214 0.2
215 0.17
216 0.21
217 0.21
218 0.28
219 0.33
220 0.33
221 0.37
222 0.37
223 0.43
224 0.42
225 0.49
226 0.49
227 0.49
228 0.49
229 0.53
230 0.6
231 0.61
232 0.63
233 0.63
234 0.65
235 0.69
236 0.68
237 0.69
238 0.65
239 0.64
240 0.65
241 0.6
242 0.51
243 0.44
244 0.44
245 0.39
246 0.37
247 0.32
248 0.27
249 0.29
250 0.34
251 0.36
252 0.35
253 0.32
254 0.31
255 0.34
256 0.41
257 0.37
258 0.39
259 0.42
260 0.43
261 0.45
262 0.48
263 0.45
264 0.4
265 0.42
266 0.41
267 0.36
268 0.36
269 0.34
270 0.41
271 0.42
272 0.44
273 0.42
274 0.4
275 0.38
276 0.35
277 0.34
278 0.26
279 0.25
280 0.21
281 0.19
282 0.16
283 0.13
284 0.12
285 0.11
286 0.12
287 0.11
288 0.11
289 0.12
290 0.15
291 0.17
292 0.18
293 0.23
294 0.25
295 0.26
296 0.27
297 0.28
298 0.27
299 0.27
300 0.28
301 0.26
302 0.26
303 0.25
304 0.25
305 0.22
306 0.19
307 0.18
308 0.18
309 0.21
310 0.19
311 0.18
312 0.18
313 0.23
314 0.28
315 0.38
316 0.47
317 0.51
318 0.6
319 0.67
320 0.75
321 0.76
322 0.78
323 0.76
324 0.73
325 0.69
326 0.62
327 0.57
328 0.48
329 0.4
330 0.33
331 0.25
332 0.17
333 0.12
334 0.09
335 0.09
336 0.08
337 0.08
338 0.09
339 0.09
340 0.1
341 0.1
342 0.1
343 0.07
344 0.07
345 0.07
346 0.07
347 0.07
348 0.06
349 0.05
350 0.04
351 0.04
352 0.04
353 0.04
354 0.04
355 0.04
356 0.03
357 0.04
358 0.06
359 0.08
360 0.1
361 0.1
362 0.12
363 0.13
364 0.13
365 0.13
366 0.12
367 0.1
368 0.09
369 0.11
370 0.1
371 0.12
372 0.12
373 0.13
374 0.15
375 0.16
376 0.16
377 0.19
378 0.19
379 0.2
380 0.28
381 0.28
382 0.28
383 0.28
384 0.28
385 0.25
386 0.28
387 0.25
388 0.16
389 0.15
390 0.14
391 0.13
392 0.15
393 0.14
394 0.11
395 0.1
396 0.1
397 0.11
398 0.1
399 0.1
400 0.12
401 0.16
402 0.19
403 0.22
404 0.27
405 0.32
406 0.36
407 0.42
408 0.48
409 0.54
410 0.58
411 0.64
412 0.7
413 0.74
414 0.82
415 0.85
416 0.86
417 0.88
418 0.91
419 0.9
420 0.89
421 0.88
422 0.87
423 0.87
424 0.86
425 0.85
426 0.85
427 0.87
428 0.88
429 0.84
430 0.83
431 0.83
432 0.79
433 0.73
434 0.64
435 0.58
436 0.52
437 0.47
438 0.37
439 0.28
440 0.22
441 0.2
442 0.18
443 0.15
444 0.13
445 0.14
446 0.14
447 0.17
448 0.17
449 0.17
450 0.18
451 0.16
452 0.16
453 0.16
454 0.19
455 0.19
456 0.23
457 0.24
458 0.27
459 0.28
460 0.28
461 0.28
462 0.24
463 0.21
464 0.19
465 0.16
466 0.13
467 0.13
468 0.11
469 0.11
470 0.1
471 0.09
472 0.07
473 0.07
474 0.06
475 0.05
476 0.05
477 0.05
478 0.05
479 0.09
480 0.13
481 0.17
482 0.2
483 0.24
484 0.27
485 0.28
486 0.35
487 0.41
488 0.47
489 0.54
490 0.6
491 0.67
492 0.72
493 0.79
494 0.77
495 0.72
496 0.72
497 0.71
498 0.72
499 0.71
500 0.71
501 0.65
502 0.7
503 0.76
504 0.74
505 0.73
506 0.69
507 0.71
508 0.71
509 0.77
510 0.75
511 0.75
512 0.77
513 0.77
514 0.76
515 0.74
516 0.75
517 0.71
518 0.7
519 0.64
520 0.61
521 0.59
522 0.61