Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074RKG2

Protein Details
Accession A0A074RKG2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
67-86PWPFLNRHPLKWRKIKNKGEHydrophilic
NLS Segment(s)
PositionSequence
79-82RKIK
Subcellular Location(s) plas 15, mito 5, E.R. 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009542  Spc1/SPCS1  
Gene Ontology GO:0005787  C:signal peptidase complex  
GO:0006465  P:signal peptide processing  
Pfam View protein in Pfam  
PF06645  SPC12  
Amino Acid Sequences MSAQIQAILDGKIDFEGQELVETSMRYGLAGATAFSFVAGYATQSLKICFGSFGLAVLAIMLTFVPPWPFLNRHPLKWRKIKNKGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.07
5 0.08
6 0.08
7 0.09
8 0.1
9 0.1
10 0.09
11 0.1
12 0.09
13 0.09
14 0.08
15 0.06
16 0.06
17 0.06
18 0.06
19 0.05
20 0.06
21 0.05
22 0.05
23 0.05
24 0.04
25 0.04
26 0.04
27 0.04
28 0.05
29 0.06
30 0.07
31 0.07
32 0.08
33 0.08
34 0.09
35 0.08
36 0.07
37 0.07
38 0.07
39 0.07
40 0.07
41 0.06
42 0.06
43 0.05
44 0.05
45 0.04
46 0.03
47 0.03
48 0.02
49 0.02
50 0.03
51 0.03
52 0.04
53 0.06
54 0.08
55 0.12
56 0.16
57 0.19
58 0.3
59 0.34
60 0.41
61 0.51
62 0.57
63 0.63
64 0.7
65 0.78
66 0.79