Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074S5U1

Protein Details
Accession A0A074S5U1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
17-39WKTPWRLSPTRKTNQRERLKRVDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPSSVNLSGLLWKTPWRLSPTRKTNQRERLKRVDAVIEAVRASGVECAALTKALALPKEHEMPAKDKYTTFVKSAKGYRKGIHKVPKFTRLTLRENPKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.17
4 0.18
5 0.21
6 0.22
7 0.25
8 0.28
9 0.35
10 0.42
11 0.52
12 0.59
13 0.66
14 0.73
15 0.75
16 0.78
17 0.81
18 0.83
19 0.82
20 0.8
21 0.8
22 0.75
23 0.71
24 0.62
25 0.55
26 0.44
27 0.38
28 0.31
29 0.22
30 0.17
31 0.14
32 0.12
33 0.09
34 0.08
35 0.05
36 0.04
37 0.03
38 0.03
39 0.04
40 0.04
41 0.04
42 0.04
43 0.03
44 0.05
45 0.07
46 0.08
47 0.08
48 0.11
49 0.14
50 0.17
51 0.17
52 0.18
53 0.18
54 0.21
55 0.25
56 0.26
57 0.24
58 0.22
59 0.24
60 0.27
61 0.28
62 0.27
63 0.27
64 0.27
65 0.32
66 0.4
67 0.46
68 0.48
69 0.49
70 0.51
71 0.57
72 0.6
73 0.63
74 0.66
75 0.65
76 0.67
77 0.7
78 0.76
79 0.7
80 0.68
81 0.69
82 0.65
83 0.65
84 0.64
85 0.67