Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074SBS4

Protein Details
Accession A0A074SBS4    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
149-170PPPMLSSPPKRRSPKKTGEHIYHydrophilic
NLS Segment(s)
PositionSequence
158-163KRRSPK
Subcellular Location(s) mito 11, nucl 7, cyto 7, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR032640  AMPK1_CBM  
IPR006828  ASC_dom  
IPR037256  ASC_dom_sf  
IPR013783  Ig-like_fold  
IPR014756  Ig_E-set  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0016301  F:kinase activity  
GO:0016310  P:phosphorylation  
Pfam View protein in Pfam  
PF16561  AMPK1_CBM  
PF04739  AMPKBI  
CDD cd02859  E_set_AMPKbeta_like_N  
Amino Acid Sequences MGQTASHPPAHTLDPRARSRGPSPAPGRAHSPLPTPLPTPTPTPTVRKPTHGPRKRSLELPDLTNKLTLTPHVRSPPPQSIPIPIRGTADRDREQIHRFNNTDSQLDVQAMNDVLPAPQYPHHGPSPSHRRGYHAPPSSLVARPAASTPPPMLSSPPKRRSPKKTGEHIYSTIPLGVSKGKARAETPSTPLKTLVSTRICWRGDGLRVELAGTFDKDWQGRRTLVWDPTARAHVTTLDLRPGTYRLKFIVDDQWKCSDHLPTAVDDVGNLVNYIEVADETFGEVLGWEKGLTSAPDQLPPWTSEIPPLLIQAAQLEENYLVRRGEPNSPSPPLIPHPPALPRHLEKVILNARSTGTASAASGVGKPTVASMGGVGPAGGADDNSVLPVPNHVVLNHLGTSAIKGGVLAVGTTTRYHRKYITTIYYKPVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.5
3 0.54
4 0.54
5 0.54
6 0.54
7 0.57
8 0.54
9 0.56
10 0.56
11 0.59
12 0.6
13 0.57
14 0.59
15 0.52
16 0.51
17 0.44
18 0.42
19 0.39
20 0.39
21 0.39
22 0.35
23 0.35
24 0.35
25 0.34
26 0.34
27 0.32
28 0.34
29 0.36
30 0.41
31 0.47
32 0.52
33 0.54
34 0.56
35 0.61
36 0.66
37 0.72
38 0.74
39 0.74
40 0.73
41 0.79
42 0.76
43 0.74
44 0.69
45 0.67
46 0.61
47 0.59
48 0.57
49 0.5
50 0.47
51 0.43
52 0.37
53 0.29
54 0.27
55 0.25
56 0.24
57 0.24
58 0.3
59 0.34
60 0.37
61 0.4
62 0.47
63 0.52
64 0.49
65 0.51
66 0.47
67 0.49
68 0.5
69 0.53
70 0.49
71 0.4
72 0.39
73 0.35
74 0.4
75 0.38
76 0.42
77 0.36
78 0.37
79 0.38
80 0.4
81 0.44
82 0.45
83 0.43
84 0.43
85 0.42
86 0.43
87 0.46
88 0.43
89 0.39
90 0.33
91 0.3
92 0.23
93 0.23
94 0.19
95 0.13
96 0.12
97 0.11
98 0.1
99 0.08
100 0.07
101 0.06
102 0.07
103 0.07
104 0.07
105 0.09
106 0.15
107 0.16
108 0.2
109 0.23
110 0.26
111 0.27
112 0.35
113 0.44
114 0.45
115 0.49
116 0.46
117 0.49
118 0.52
119 0.59
120 0.59
121 0.55
122 0.49
123 0.44
124 0.47
125 0.44
126 0.39
127 0.32
128 0.24
129 0.17
130 0.17
131 0.17
132 0.16
133 0.14
134 0.14
135 0.14
136 0.14
137 0.15
138 0.15
139 0.17
140 0.23
141 0.33
142 0.42
143 0.49
144 0.56
145 0.63
146 0.72
147 0.78
148 0.8
149 0.8
150 0.79
151 0.81
152 0.79
153 0.77
154 0.72
155 0.64
156 0.56
157 0.47
158 0.38
159 0.28
160 0.21
161 0.15
162 0.11
163 0.11
164 0.1
165 0.11
166 0.15
167 0.16
168 0.17
169 0.17
170 0.21
171 0.25
172 0.26
173 0.28
174 0.32
175 0.31
176 0.31
177 0.31
178 0.27
179 0.23
180 0.22
181 0.26
182 0.2
183 0.21
184 0.23
185 0.31
186 0.3
187 0.29
188 0.29
189 0.24
190 0.26
191 0.26
192 0.25
193 0.18
194 0.17
195 0.18
196 0.16
197 0.14
198 0.1
199 0.09
200 0.08
201 0.07
202 0.09
203 0.1
204 0.12
205 0.13
206 0.16
207 0.16
208 0.16
209 0.19
210 0.21
211 0.23
212 0.25
213 0.25
214 0.24
215 0.25
216 0.27
217 0.23
218 0.19
219 0.17
220 0.12
221 0.13
222 0.15
223 0.14
224 0.14
225 0.14
226 0.14
227 0.14
228 0.16
229 0.18
230 0.16
231 0.17
232 0.15
233 0.17
234 0.18
235 0.19
236 0.26
237 0.3
238 0.3
239 0.32
240 0.35
241 0.34
242 0.34
243 0.34
244 0.27
245 0.2
246 0.22
247 0.2
248 0.16
249 0.17
250 0.16
251 0.14
252 0.12
253 0.12
254 0.09
255 0.08
256 0.07
257 0.05
258 0.04
259 0.05
260 0.05
261 0.04
262 0.03
263 0.03
264 0.03
265 0.04
266 0.04
267 0.04
268 0.04
269 0.04
270 0.04
271 0.05
272 0.05
273 0.05
274 0.04
275 0.04
276 0.05
277 0.06
278 0.07
279 0.08
280 0.14
281 0.15
282 0.18
283 0.18
284 0.19
285 0.2
286 0.2
287 0.23
288 0.18
289 0.18
290 0.18
291 0.19
292 0.2
293 0.18
294 0.17
295 0.14
296 0.12
297 0.12
298 0.1
299 0.1
300 0.08
301 0.08
302 0.08
303 0.08
304 0.09
305 0.1
306 0.11
307 0.1
308 0.1
309 0.14
310 0.16
311 0.23
312 0.26
313 0.31
314 0.35
315 0.38
316 0.38
317 0.35
318 0.36
319 0.32
320 0.36
321 0.32
322 0.28
323 0.3
324 0.35
325 0.37
326 0.38
327 0.41
328 0.36
329 0.4
330 0.4
331 0.39
332 0.33
333 0.39
334 0.42
335 0.38
336 0.36
337 0.31
338 0.3
339 0.29
340 0.29
341 0.2
342 0.14
343 0.12
344 0.11
345 0.11
346 0.11
347 0.1
348 0.1
349 0.11
350 0.1
351 0.09
352 0.09
353 0.08
354 0.09
355 0.08
356 0.07
357 0.07
358 0.08
359 0.08
360 0.08
361 0.07
362 0.06
363 0.06
364 0.06
365 0.05
366 0.04
367 0.04
368 0.05
369 0.06
370 0.07
371 0.07
372 0.07
373 0.07
374 0.09
375 0.12
376 0.13
377 0.15
378 0.14
379 0.17
380 0.18
381 0.21
382 0.2
383 0.17
384 0.15
385 0.14
386 0.16
387 0.15
388 0.13
389 0.09
390 0.09
391 0.09
392 0.1
393 0.09
394 0.08
395 0.06
396 0.07
397 0.09
398 0.11
399 0.16
400 0.23
401 0.26
402 0.3
403 0.33
404 0.38
405 0.44
406 0.52
407 0.57
408 0.57
409 0.58