Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074SGQ0

Protein Details
Accession A0A074SGQ0   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
6-31MNRVRKGAIPIRRRYRDRKRQDGTIIHydrophilic
NLS Segment(s)
PositionSequence
10-25RKGAIPIRRRYRDRKR
Subcellular Location(s) mito 17, nucl 6, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPRWVMNRVRKGAIPIRRRYRDRKRQDGTIIPALRTRKRSLSLFYPAYNRQVHEGIVLCGPDDQVGSTLGMWWIDLARVHKRPIHRTFRTEWACYWVESKGYYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.6
3 0.66
4 0.71
5 0.77
6 0.8
7 0.83
8 0.84
9 0.86
10 0.86
11 0.81
12 0.8
13 0.8
14 0.76
15 0.71
16 0.7
17 0.61
18 0.5
19 0.49
20 0.45
21 0.43
22 0.4
23 0.36
24 0.32
25 0.35
26 0.37
27 0.37
28 0.38
29 0.4
30 0.38
31 0.37
32 0.37
33 0.34
34 0.36
35 0.33
36 0.27
37 0.23
38 0.21
39 0.19
40 0.17
41 0.16
42 0.12
43 0.11
44 0.11
45 0.08
46 0.08
47 0.07
48 0.06
49 0.05
50 0.04
51 0.05
52 0.05
53 0.06
54 0.05
55 0.06
56 0.06
57 0.06
58 0.06
59 0.05
60 0.04
61 0.05
62 0.07
63 0.1
64 0.18
65 0.21
66 0.24
67 0.28
68 0.35
69 0.44
70 0.52
71 0.59
72 0.58
73 0.61
74 0.63
75 0.7
76 0.69
77 0.62
78 0.53
79 0.49
80 0.44
81 0.39
82 0.36
83 0.27
84 0.23