Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6C668

Protein Details
Accession Q6C668    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
47-68AVSPCQKRAKVVKKPAKTKAPVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito_nucl 10.333, cyto_nucl 9.333, mito 6.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028005  AcTrfase_ESCO_Znf_dom  
IPR028009  ESCO_Acetyltransf_dom  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0061733  F:peptide-lysine-N-acetyltransferase activity  
GO:0007064  P:mitotic sister chromatid cohesion  
KEGG yli:YALI0E12023g  -  
Pfam View protein in Pfam  
PF13880  Acetyltransf_13  
PF13878  zf-C2H2_3  
Amino Acid Sequences MKTYRAKRKYLSESEDDVFSSSPTQSPETSPLQPPNESRLNIKAAQAVSPCQKRAKVVKKPAKTKAPVQMTLSLGQTTSTTCKTCGMTYQVAYGPDISAHKSFHSTALNGPKWKPSVSAVVVDKSKTYTVYKSRLLSHPCVSQFLKLVNSELNAPEPILSSQAAVYVYVVDQRAVGCVLVDRITKCRHVDIQTGTLGLKEYPAVMGVSRMYVSQLFRRTGIVTKLLDLAKSDFIYGMELEKNQVAFTQPSEGGLKVAENWAGTVRVYREGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.57
3 0.47
4 0.39
5 0.29
6 0.23
7 0.18
8 0.13
9 0.13
10 0.15
11 0.17
12 0.17
13 0.2
14 0.25
15 0.28
16 0.32
17 0.35
18 0.4
19 0.41
20 0.44
21 0.43
22 0.45
23 0.46
24 0.43
25 0.41
26 0.38
27 0.4
28 0.38
29 0.37
30 0.35
31 0.29
32 0.31
33 0.29
34 0.28
35 0.32
36 0.34
37 0.36
38 0.36
39 0.37
40 0.4
41 0.49
42 0.55
43 0.57
44 0.64
45 0.71
46 0.76
47 0.83
48 0.86
49 0.85
50 0.79
51 0.76
52 0.74
53 0.72
54 0.66
55 0.6
56 0.56
57 0.49
58 0.46
59 0.39
60 0.3
61 0.22
62 0.19
63 0.15
64 0.11
65 0.12
66 0.13
67 0.13
68 0.13
69 0.16
70 0.17
71 0.18
72 0.2
73 0.22
74 0.22
75 0.22
76 0.24
77 0.23
78 0.22
79 0.22
80 0.18
81 0.13
82 0.12
83 0.12
84 0.12
85 0.11
86 0.11
87 0.12
88 0.13
89 0.14
90 0.16
91 0.17
92 0.15
93 0.19
94 0.28
95 0.31
96 0.31
97 0.31
98 0.32
99 0.31
100 0.31
101 0.27
102 0.2
103 0.22
104 0.21
105 0.25
106 0.23
107 0.24
108 0.24
109 0.23
110 0.21
111 0.17
112 0.16
113 0.13
114 0.13
115 0.15
116 0.2
117 0.25
118 0.28
119 0.3
120 0.33
121 0.36
122 0.39
123 0.37
124 0.34
125 0.34
126 0.31
127 0.32
128 0.29
129 0.25
130 0.22
131 0.2
132 0.19
133 0.15
134 0.15
135 0.12
136 0.12
137 0.12
138 0.11
139 0.11
140 0.09
141 0.09
142 0.08
143 0.08
144 0.08
145 0.08
146 0.08
147 0.06
148 0.06
149 0.08
150 0.08
151 0.07
152 0.06
153 0.05
154 0.05
155 0.07
156 0.08
157 0.06
158 0.07
159 0.07
160 0.07
161 0.07
162 0.07
163 0.05
164 0.05
165 0.06
166 0.08
167 0.1
168 0.1
169 0.14
170 0.17
171 0.21
172 0.21
173 0.24
174 0.28
175 0.3
176 0.35
177 0.34
178 0.35
179 0.33
180 0.32
181 0.28
182 0.23
183 0.2
184 0.14
185 0.1
186 0.07
187 0.06
188 0.06
189 0.07
190 0.07
191 0.06
192 0.07
193 0.07
194 0.08
195 0.08
196 0.08
197 0.08
198 0.1
199 0.13
200 0.18
201 0.23
202 0.23
203 0.24
204 0.26
205 0.26
206 0.29
207 0.3
208 0.29
209 0.24
210 0.24
211 0.29
212 0.27
213 0.26
214 0.23
215 0.22
216 0.2
217 0.2
218 0.19
219 0.14
220 0.14
221 0.15
222 0.14
223 0.14
224 0.12
225 0.12
226 0.14
227 0.15
228 0.15
229 0.13
230 0.14
231 0.14
232 0.14
233 0.15
234 0.19
235 0.17
236 0.19
237 0.21
238 0.21
239 0.18
240 0.17
241 0.16
242 0.12
243 0.15
244 0.14
245 0.12
246 0.12
247 0.14
248 0.14
249 0.14
250 0.17
251 0.17