Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6C5V7

Protein Details
Accession Q6C5V7   
Localization Confidence High
Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
32-53DLKFYETRKRIQQRDNQIHKFIHydrophilic
NLS Segment(s)
PositionSequence
169-177PGTRPPKKR
274-283KGRKGDKKKR
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR028651  ING_fam  
IPR024610  ING_N_histone-binding  
IPR019786  Zinc_finger_PHD-type_CS  
IPR011011  Znf_FYVE_PHD  
IPR001965  Znf_PHD  
IPR019787  Znf_PHD-finger  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0005634  C:nucleus  
GO:0033698  C:Rpd3L complex  
GO:0046872  F:metal ion binding  
GO:0035064  F:methylated histone binding  
GO:0006325  P:chromatin organization  
GO:0006281  P:DNA repair  
GO:0051321  P:meiotic cell cycle  
GO:0006355  P:regulation of DNA-templated transcription  
KEGG yli:YALI0E14773g  -  
Pfam View protein in Pfam  
PF12998  ING  
PROSITE View protein in PROSITE  
PS01359  ZF_PHD_1  
PS50016  ZF_PHD_2  
CDD cd16858  ING_ING3_Yng2p  
cd15505  PHD_ING  
Amino Acid Sequences MDAASVLDQYVQDLANLPSEVAHILEEVRDKDLKFYETRKRIQQRDNQIHKFIRANGSLAENPKEQAAYPKIRQDFQTAMELQDEKCTLAAQALTLVAKHVKKLNDDIDKLDAEGLLGGAPPQKPISANRSRATSSATPAPEPPSRNYTRDRANSRRGGSPAASRSSTPGTRPPKKRATDKNNEAASMSKESSVGASEQLRNMPETVAVGSLDAAIRAGPGEDDEVLYCFCQQPSFGEMVACDNDDCQYEWFHYDCVGLAEPPQGVWFCPSCSKGRKGDKKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.14
3 0.14
4 0.13
5 0.12
6 0.12
7 0.13
8 0.11
9 0.1
10 0.07
11 0.07
12 0.09
13 0.13
14 0.13
15 0.16
16 0.19
17 0.19
18 0.22
19 0.25
20 0.27
21 0.28
22 0.35
23 0.42
24 0.48
25 0.54
26 0.6
27 0.67
28 0.72
29 0.76
30 0.78
31 0.79
32 0.81
33 0.86
34 0.81
35 0.79
36 0.73
37 0.68
38 0.63
39 0.56
40 0.51
41 0.42
42 0.38
43 0.32
44 0.34
45 0.33
46 0.32
47 0.3
48 0.24
49 0.23
50 0.23
51 0.21
52 0.17
53 0.21
54 0.25
55 0.29
56 0.31
57 0.39
58 0.4
59 0.42
60 0.44
61 0.41
62 0.36
63 0.32
64 0.35
65 0.28
66 0.26
67 0.26
68 0.25
69 0.21
70 0.21
71 0.19
72 0.12
73 0.12
74 0.11
75 0.09
76 0.09
77 0.09
78 0.06
79 0.06
80 0.07
81 0.07
82 0.06
83 0.07
84 0.1
85 0.11
86 0.13
87 0.16
88 0.18
89 0.2
90 0.25
91 0.32
92 0.34
93 0.35
94 0.35
95 0.33
96 0.31
97 0.29
98 0.24
99 0.16
100 0.1
101 0.08
102 0.06
103 0.03
104 0.03
105 0.03
106 0.06
107 0.06
108 0.07
109 0.07
110 0.08
111 0.09
112 0.12
113 0.21
114 0.26
115 0.32
116 0.33
117 0.36
118 0.36
119 0.35
120 0.37
121 0.3
122 0.24
123 0.24
124 0.23
125 0.21
126 0.21
127 0.25
128 0.23
129 0.24
130 0.24
131 0.26
132 0.28
133 0.31
134 0.33
135 0.34
136 0.38
137 0.44
138 0.5
139 0.49
140 0.54
141 0.57
142 0.56
143 0.56
144 0.49
145 0.44
146 0.37
147 0.36
148 0.31
149 0.28
150 0.26
151 0.22
152 0.23
153 0.25
154 0.25
155 0.21
156 0.27
157 0.33
158 0.42
159 0.49
160 0.54
161 0.59
162 0.64
163 0.72
164 0.75
165 0.75
166 0.77
167 0.77
168 0.78
169 0.7
170 0.64
171 0.55
172 0.46
173 0.38
174 0.31
175 0.24
176 0.15
177 0.14
178 0.14
179 0.14
180 0.13
181 0.1
182 0.09
183 0.12
184 0.13
185 0.14
186 0.16
187 0.16
188 0.16
189 0.16
190 0.14
191 0.11
192 0.11
193 0.1
194 0.09
195 0.08
196 0.07
197 0.06
198 0.07
199 0.06
200 0.05
201 0.05
202 0.04
203 0.04
204 0.04
205 0.04
206 0.04
207 0.04
208 0.06
209 0.06
210 0.07
211 0.07
212 0.08
213 0.09
214 0.09
215 0.09
216 0.1
217 0.1
218 0.1
219 0.1
220 0.12
221 0.14
222 0.16
223 0.15
224 0.14
225 0.14
226 0.17
227 0.17
228 0.15
229 0.12
230 0.11
231 0.12
232 0.13
233 0.14
234 0.11
235 0.12
236 0.13
237 0.16
238 0.16
239 0.16
240 0.15
241 0.14
242 0.14
243 0.15
244 0.14
245 0.12
246 0.12
247 0.14
248 0.14
249 0.13
250 0.15
251 0.13
252 0.12
253 0.16
254 0.16
255 0.17
256 0.22
257 0.26
258 0.31
259 0.39
260 0.45
261 0.51
262 0.6
263 0.69