Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074SA75

Protein Details
Accession A0A074SA75    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
37-58NAPTSNKKRLTRRDSRRCNTKNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, mito 9, cyto 2, plas 2, extr 2
Family & Domain DBs
Amino Acid Sequences MWSLSTVLCCMLRLSKATSAFCWAPCHTFWFTFEVSNAPTSNKKRLTRRDSRRCNTKNLKGFELEWTLARVWQRRSRCLLRALRLDHGRYIRSIPLKSRSNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.29
4 0.3
5 0.29
6 0.32
7 0.32
8 0.31
9 0.32
10 0.27
11 0.25
12 0.24
13 0.28
14 0.25
15 0.24
16 0.23
17 0.23
18 0.22
19 0.2
20 0.2
21 0.17
22 0.15
23 0.16
24 0.15
25 0.13
26 0.19
27 0.22
28 0.29
29 0.35
30 0.4
31 0.47
32 0.57
33 0.64
34 0.68
35 0.76
36 0.79
37 0.82
38 0.83
39 0.85
40 0.77
41 0.79
42 0.77
43 0.75
44 0.72
45 0.65
46 0.6
47 0.51
48 0.49
49 0.42
50 0.37
51 0.28
52 0.21
53 0.19
54 0.17
55 0.17
56 0.19
57 0.2
58 0.23
59 0.3
60 0.34
61 0.39
62 0.47
63 0.51
64 0.53
65 0.58
66 0.6
67 0.6
68 0.63
69 0.61
70 0.61
71 0.6
72 0.57
73 0.54
74 0.5
75 0.44
76 0.38
77 0.37
78 0.36
79 0.36
80 0.38
81 0.39
82 0.44