Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074RU75

Protein Details
Accession A0A074RU75    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
7-33KKTTLACDSCRRRKRKCDGRTPVCSLCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MAEPRVKKTTLACDSCRRRKRKCDGRTPVCSLCEKGNTECVYDATQDQRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.71
3 0.75
4 0.73
5 0.73
6 0.77
7 0.83
8 0.83
9 0.83
10 0.84
11 0.85
12 0.86
13 0.84
14 0.8
15 0.72
16 0.64
17 0.56
18 0.46
19 0.39
20 0.35
21 0.31
22 0.27
23 0.31
24 0.29
25 0.29
26 0.28
27 0.27
28 0.23
29 0.22
30 0.23