Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074RMD6

Protein Details
Accession A0A074RMD6   
Localization Confidence Low
Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-30IPANLSQTPNRKKKHVKDPTAFHGSYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto_nucl 7.5, nucl 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR045338  DUF6535  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF20153  DUF6535  
Amino Acid Sequences MSPLIPANLSQTPNRKKKHVKDPTAFHGSYEEVLQKPHAVPITPVDPLELLEPDEPGAELAKEARVWKVYVKEADKWDTELIEGWNRSLDVILVFAALFSAVLTAFIIESSNMLEQDPNEVSAAALSQSQLGRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.62
3 0.68
4 0.75
5 0.81
6 0.82
7 0.82
8 0.82
9 0.85
10 0.83
11 0.81
12 0.71
13 0.6
14 0.51
15 0.41
16 0.33
17 0.27
18 0.22
19 0.14
20 0.15
21 0.15
22 0.14
23 0.14
24 0.16
25 0.15
26 0.13
27 0.13
28 0.16
29 0.18
30 0.16
31 0.16
32 0.13
33 0.12
34 0.12
35 0.12
36 0.09
37 0.08
38 0.08
39 0.08
40 0.07
41 0.07
42 0.07
43 0.06
44 0.06
45 0.04
46 0.04
47 0.04
48 0.05
49 0.06
50 0.07
51 0.08
52 0.08
53 0.09
54 0.11
55 0.14
56 0.16
57 0.2
58 0.22
59 0.25
60 0.27
61 0.29
62 0.28
63 0.26
64 0.24
65 0.19
66 0.17
67 0.14
68 0.13
69 0.14
70 0.13
71 0.12
72 0.12
73 0.12
74 0.11
75 0.1
76 0.09
77 0.05
78 0.05
79 0.05
80 0.05
81 0.04
82 0.04
83 0.04
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.04
93 0.04
94 0.04
95 0.04
96 0.05
97 0.06
98 0.07
99 0.08
100 0.08
101 0.09
102 0.09
103 0.14
104 0.14
105 0.14
106 0.13
107 0.13
108 0.12
109 0.12
110 0.12
111 0.08
112 0.07
113 0.07
114 0.1