Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074SFE5

Protein Details
Accession A0A074SFE5    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
69-101YEGHNTPCRRCRRAKRPCVPRQRAPRARPQSEAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 5, extr 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MDPYRSQPGGSRGTACVFVHRLLLLIHPPPCIGYSSSSASASASSPNSTSSGSSNACTYCHERKRRCVYEGHNTPCRRCRRAKRPCVPRQRAPRARPQSEAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.3
3 0.28
4 0.25
5 0.23
6 0.22
7 0.19
8 0.18
9 0.14
10 0.16
11 0.14
12 0.16
13 0.17
14 0.16
15 0.16
16 0.16
17 0.16
18 0.16
19 0.14
20 0.13
21 0.15
22 0.17
23 0.19
24 0.18
25 0.18
26 0.16
27 0.16
28 0.13
29 0.12
30 0.1
31 0.09
32 0.09
33 0.1
34 0.11
35 0.1
36 0.1
37 0.09
38 0.12
39 0.12
40 0.12
41 0.13
42 0.12
43 0.12
44 0.14
45 0.18
46 0.24
47 0.32
48 0.41
49 0.45
50 0.55
51 0.65
52 0.68
53 0.65
54 0.63
55 0.61
56 0.63
57 0.68
58 0.65
59 0.63
60 0.59
61 0.61
62 0.62
63 0.64
64 0.59
65 0.6
66 0.65
67 0.67
68 0.77
69 0.83
70 0.86
71 0.89
72 0.93
73 0.94
74 0.91
75 0.9
76 0.9
77 0.9
78 0.9
79 0.85
80 0.85
81 0.85
82 0.81