Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074S721

Protein Details
Accession A0A074S721   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-21LLVRRLPRTRINPNLHRLTFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 12.333, cyto 3, cyto_nucl 2.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR010987  Glutathione-S-Trfase_C-like  
IPR036282  Glutathione-S-Trfase_C_sf  
IPR004045  Glutathione_S-Trfase_N  
IPR047047  GST_Omega-like_C  
IPR016639  GST_Omega/GSH  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0004364  F:glutathione transferase activity  
Pfam View protein in Pfam  
PF13410  GST_C_2  
PF13409  GST_N_2  
PROSITE View protein in PROSITE  
PS50405  GST_CTER  
CDD cd03190  GST_C_Omega_like  
Amino Acid Sequences MLLVRRLPRTRINPNLHRLTFFARAMSQDKSEAQKDITKWASTDGHFRRQVSSFRDAIEKGGKFEPEKGRYHIFVSYACPWAHRVLITRKLLKLDDVIGLSVVSPRMGALGWPFAAADEFPGADHDPVQNSNHVRDLYFKADSEYSGRFTVPIVWDKKTSTIVNNESSEIIRFLNSAFRDLAEPTDIDIYPELLRKEIDDFHSWVYDTVNNGVYKCGFATTQEAYESAVGPLFQSLDRLEKMIEGKEYYIGDRLTEADIRLYTTIVRFDPVYHGHFKCNLGSIRHNYPNINRWMKNLYWNVPAFKETTNFEHIKTHYYWSHTQINPHRVVPQGPNPNIEAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.83
3 0.75
4 0.68
5 0.61
6 0.56
7 0.52
8 0.44
9 0.37
10 0.29
11 0.31
12 0.32
13 0.33
14 0.29
15 0.25
16 0.28
17 0.32
18 0.33
19 0.31
20 0.31
21 0.34
22 0.33
23 0.38
24 0.39
25 0.34
26 0.32
27 0.35
28 0.37
29 0.32
30 0.41
31 0.38
32 0.44
33 0.47
34 0.47
35 0.47
36 0.46
37 0.51
38 0.47
39 0.47
40 0.39
41 0.37
42 0.4
43 0.36
44 0.36
45 0.37
46 0.32
47 0.3
48 0.31
49 0.32
50 0.29
51 0.37
52 0.42
53 0.4
54 0.43
55 0.44
56 0.45
57 0.44
58 0.45
59 0.39
60 0.31
61 0.27
62 0.28
63 0.26
64 0.26
65 0.25
66 0.23
67 0.23
68 0.23
69 0.23
70 0.2
71 0.23
72 0.26
73 0.35
74 0.4
75 0.43
76 0.43
77 0.45
78 0.44
79 0.38
80 0.32
81 0.26
82 0.22
83 0.18
84 0.16
85 0.13
86 0.12
87 0.11
88 0.1
89 0.08
90 0.06
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.06
97 0.07
98 0.08
99 0.08
100 0.08
101 0.07
102 0.08
103 0.07
104 0.06
105 0.05
106 0.05
107 0.05
108 0.06
109 0.07
110 0.07
111 0.08
112 0.08
113 0.09
114 0.11
115 0.12
116 0.15
117 0.16
118 0.17
119 0.2
120 0.19
121 0.18
122 0.2
123 0.23
124 0.22
125 0.22
126 0.2
127 0.19
128 0.19
129 0.19
130 0.18
131 0.16
132 0.14
133 0.14
134 0.14
135 0.12
136 0.12
137 0.14
138 0.14
139 0.19
140 0.19
141 0.2
142 0.22
143 0.22
144 0.24
145 0.24
146 0.23
147 0.19
148 0.23
149 0.25
150 0.27
151 0.27
152 0.26
153 0.23
154 0.22
155 0.19
156 0.14
157 0.11
158 0.07
159 0.07
160 0.06
161 0.1
162 0.1
163 0.11
164 0.11
165 0.11
166 0.12
167 0.12
168 0.12
169 0.09
170 0.08
171 0.07
172 0.1
173 0.09
174 0.08
175 0.08
176 0.09
177 0.09
178 0.11
179 0.11
180 0.09
181 0.1
182 0.1
183 0.12
184 0.13
185 0.15
186 0.16
187 0.17
188 0.17
189 0.18
190 0.18
191 0.16
192 0.15
193 0.13
194 0.11
195 0.11
196 0.14
197 0.14
198 0.14
199 0.15
200 0.13
201 0.12
202 0.12
203 0.1
204 0.07
205 0.07
206 0.11
207 0.12
208 0.13
209 0.13
210 0.13
211 0.12
212 0.13
213 0.12
214 0.09
215 0.08
216 0.06
217 0.06
218 0.06
219 0.06
220 0.06
221 0.07
222 0.07
223 0.11
224 0.11
225 0.12
226 0.12
227 0.13
228 0.15
229 0.16
230 0.16
231 0.14
232 0.14
233 0.16
234 0.17
235 0.16
236 0.17
237 0.15
238 0.14
239 0.13
240 0.14
241 0.13
242 0.14
243 0.13
244 0.12
245 0.12
246 0.13
247 0.13
248 0.12
249 0.11
250 0.11
251 0.13
252 0.12
253 0.13
254 0.12
255 0.13
256 0.17
257 0.2
258 0.23
259 0.28
260 0.29
261 0.31
262 0.34
263 0.35
264 0.32
265 0.35
266 0.35
267 0.32
268 0.38
269 0.4
270 0.45
271 0.5
272 0.51
273 0.49
274 0.5
275 0.54
276 0.56
277 0.59
278 0.51
279 0.49
280 0.52
281 0.5
282 0.53
283 0.51
284 0.46
285 0.45
286 0.47
287 0.46
288 0.42
289 0.42
290 0.35
291 0.3
292 0.29
293 0.25
294 0.27
295 0.31
296 0.31
297 0.31
298 0.36
299 0.35
300 0.37
301 0.36
302 0.37
303 0.33
304 0.38
305 0.42
306 0.41
307 0.49
308 0.46
309 0.54
310 0.57
311 0.62
312 0.6
313 0.57
314 0.55
315 0.48
316 0.51
317 0.49
318 0.49
319 0.51
320 0.5
321 0.51