Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074S7R2

Protein Details
Accession A0A074S7R2   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
73-113EYQPSQRVRKRRHGFLARKRKRTGRKVLARRRAKGRRSLTHBasic
NLS Segment(s)
PositionSequence
79-110RVRKRRHGFLARKRKRTGRKVLARRRAKGRRS
Subcellular Location(s) mito 19.5, mito_nucl 13.666, nucl 6.5, cyto_nucl 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRLLVRILPRLIRPTIQTIPRLSVPRISQTLPTTPSFSPILSRLGPSLSAAFRRPTISAPLGLGSGSVHGDEYQPSQRVRKRRHGFLARKRKRTGRKVLARRRAKGRRSLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.36
3 0.39
4 0.4
5 0.41
6 0.38
7 0.4
8 0.42
9 0.43
10 0.36
11 0.35
12 0.33
13 0.35
14 0.35
15 0.33
16 0.32
17 0.31
18 0.34
19 0.31
20 0.31
21 0.29
22 0.25
23 0.27
24 0.24
25 0.21
26 0.19
27 0.17
28 0.19
29 0.16
30 0.16
31 0.14
32 0.13
33 0.13
34 0.12
35 0.12
36 0.1
37 0.11
38 0.12
39 0.13
40 0.13
41 0.14
42 0.14
43 0.13
44 0.16
45 0.16
46 0.15
47 0.14
48 0.13
49 0.12
50 0.11
51 0.1
52 0.06
53 0.05
54 0.05
55 0.05
56 0.04
57 0.05
58 0.05
59 0.06
60 0.09
61 0.13
62 0.16
63 0.17
64 0.24
65 0.29
66 0.38
67 0.45
68 0.54
69 0.58
70 0.63
71 0.73
72 0.76
73 0.82
74 0.84
75 0.88
76 0.86
77 0.87
78 0.85
79 0.85
80 0.84
81 0.84
82 0.84
83 0.84
84 0.85
85 0.87
86 0.91
87 0.92
88 0.91
89 0.89
90 0.89
91 0.88
92 0.84
93 0.83