Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A066WIV3

Protein Details
Accession A0A066WIV3    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-21LNAVPKKKVSHSRKAMRAANHydrophilic
NLS Segment(s)
PositionSequence
8-18KKVSHSRKAMR
Subcellular Location(s) mito 10.5mito_nucl 10.5, nucl 9.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences LLNAVPKKKVSHSRKAMRAANKGLKDRVDLVHCQGCGRPKLAHHICGHCFKEINRWQKAEHPPTARRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.8
3 0.79
4 0.76
5 0.75
6 0.73
7 0.71
8 0.66
9 0.62
10 0.56
11 0.5
12 0.44
13 0.39
14 0.33
15 0.28
16 0.24
17 0.24
18 0.24
19 0.23
20 0.21
21 0.2
22 0.21
23 0.19
24 0.2
25 0.18
26 0.16
27 0.27
28 0.29
29 0.34
30 0.34
31 0.39
32 0.4
33 0.47
34 0.47
35 0.39
36 0.38
37 0.32
38 0.38
39 0.41
40 0.46
41 0.45
42 0.45
43 0.45
44 0.53
45 0.63
46 0.6
47 0.61
48 0.6