Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A066WEU7

Protein Details
Accession A0A066WEU7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
77-100LSPAAQQRCKRKRWVDGRNTELKGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 1.5, cyto_nucl 1.5
Family & Domain DBs
Amino Acid Sequences MRSLRLYVGLLQAEWSRGWPVRARKAELDCARQGRESGQDGRCASSPATGVERVRLAVGTADQRPSGWPAVTEKRALSPAAQQRCKRKRWVDGRNTELKGRRRNIHPTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.15
4 0.15
5 0.18
6 0.23
7 0.31
8 0.39
9 0.45
10 0.48
11 0.51
12 0.54
13 0.61
14 0.59
15 0.57
16 0.52
17 0.5
18 0.47
19 0.42
20 0.38
21 0.3
22 0.28
23 0.27
24 0.28
25 0.26
26 0.29
27 0.29
28 0.31
29 0.29
30 0.26
31 0.22
32 0.16
33 0.16
34 0.12
35 0.14
36 0.14
37 0.13
38 0.13
39 0.13
40 0.12
41 0.11
42 0.1
43 0.08
44 0.06
45 0.07
46 0.09
47 0.1
48 0.1
49 0.1
50 0.1
51 0.11
52 0.13
53 0.14
54 0.11
55 0.11
56 0.15
57 0.22
58 0.24
59 0.25
60 0.23
61 0.23
62 0.25
63 0.25
64 0.2
65 0.22
66 0.29
67 0.37
68 0.44
69 0.47
70 0.57
71 0.65
72 0.7
73 0.71
74 0.71
75 0.72
76 0.76
77 0.81
78 0.81
79 0.83
80 0.84
81 0.84
82 0.78
83 0.74
84 0.72
85 0.69
86 0.68
87 0.66
88 0.67
89 0.65