Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A066WE21

Protein Details
Accession A0A066WE21    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAATKIPIVKKKTKKFARHHSDRYHRVGEHydrophilic
NLS Segment(s)
PositionSequence
9-45VKKKTKKFARHHSDRYHRVGESWRKPKGIDSAVRRRF
Subcellular Location(s) mito 12.5, mito_nucl 11, nucl 8.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAATKIPIVKKKTKKFARHHSDRYHRVGESWRKPKGIDSAVRRRFKGTVLMPKIGYGSNKKTRHLMPNGYRRLVVSNVKDVELLLMHNASFAAEIAHNVSSKKRIDILEKAKALGVQVTNANARVRAEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.86
3 0.9
4 0.91
5 0.91
6 0.9
7 0.9
8 0.9
9 0.87
10 0.83
11 0.77
12 0.66
13 0.58
14 0.58
15 0.57
16 0.57
17 0.58
18 0.55
19 0.52
20 0.52
21 0.53
22 0.52
23 0.49
24 0.46
25 0.47
26 0.53
27 0.61
28 0.65
29 0.62
30 0.56
31 0.5
32 0.44
33 0.43
34 0.38
35 0.39
36 0.4
37 0.41
38 0.39
39 0.38
40 0.37
41 0.3
42 0.26
43 0.2
44 0.24
45 0.31
46 0.33
47 0.34
48 0.37
49 0.4
50 0.45
51 0.46
52 0.47
53 0.46
54 0.53
55 0.56
56 0.53
57 0.49
58 0.42
59 0.38
60 0.33
61 0.3
62 0.22
63 0.24
64 0.24
65 0.24
66 0.24
67 0.21
68 0.18
69 0.13
70 0.12
71 0.06
72 0.06
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.04
79 0.05
80 0.05
81 0.05
82 0.07
83 0.08
84 0.09
85 0.1
86 0.12
87 0.16
88 0.18
89 0.19
90 0.22
91 0.24
92 0.3
93 0.39
94 0.45
95 0.48
96 0.48
97 0.47
98 0.43
99 0.4
100 0.35
101 0.3
102 0.22
103 0.16
104 0.17
105 0.19
106 0.2
107 0.22
108 0.23
109 0.2
110 0.2