Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A066WIG1

Protein Details
Accession A0A066WIG1    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
12-35KVASSTTRKTKKSKDPNAIKKPLSHydrophilic
NLS Segment(s)
PositionSequence
22-23KK
Subcellular Location(s) nucl 16, mito 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences QPFKMAPKANAKVASSTTRKTKKSKDPNAIKKPLSAYMYFSQAQREQVKLENPEAGFGDVGRLLGAKWKQMTDDQKRPYVAQADADKARHEREKAARA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.41
3 0.41
4 0.45
5 0.49
6 0.53
7 0.58
8 0.64
9 0.67
10 0.74
11 0.79
12 0.8
13 0.83
14 0.89
15 0.91
16 0.89
17 0.78
18 0.7
19 0.63
20 0.57
21 0.48
22 0.38
23 0.33
24 0.26
25 0.3
26 0.27
27 0.25
28 0.23
29 0.22
30 0.26
31 0.23
32 0.22
33 0.19
34 0.21
35 0.24
36 0.23
37 0.22
38 0.21
39 0.19
40 0.19
41 0.18
42 0.15
43 0.12
44 0.09
45 0.09
46 0.06
47 0.06
48 0.05
49 0.04
50 0.04
51 0.1
52 0.11
53 0.13
54 0.14
55 0.15
56 0.17
57 0.24
58 0.34
59 0.38
60 0.47
61 0.48
62 0.52
63 0.53
64 0.52
65 0.5
66 0.44
67 0.36
68 0.34
69 0.33
70 0.34
71 0.36
72 0.36
73 0.35
74 0.33
75 0.38
76 0.37
77 0.36
78 0.38