Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A066WM05

Protein Details
Accession A0A066WM05    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-27RLYSKGRIMGHKRGKRNSRPHTTLVHydrophilic
NLS Segment(s)
PositionSequence
13-18HKRGKR
Subcellular Location(s) mito 12, nucl 10, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MSRLYSKGRIMGHKRGKRNSRPHTTLVKIDGVENQKDAQFYLGKRIAYVYRAQKEKRGTKVRVIWGRVTRPHGNSGVVRSKFAHNIPPRAFGAGVRIMLYPSTNYGNTSQHAFLVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.76
3 0.82
4 0.82
5 0.86
6 0.86
7 0.85
8 0.82
9 0.8
10 0.78
11 0.72
12 0.66
13 0.58
14 0.51
15 0.41
16 0.36
17 0.36
18 0.31
19 0.28
20 0.24
21 0.22
22 0.19
23 0.19
24 0.18
25 0.15
26 0.14
27 0.14
28 0.2
29 0.23
30 0.21
31 0.21
32 0.23
33 0.22
34 0.2
35 0.26
36 0.25
37 0.28
38 0.33
39 0.34
40 0.38
41 0.45
42 0.49
43 0.53
44 0.54
45 0.51
46 0.53
47 0.59
48 0.61
49 0.59
50 0.55
51 0.52
52 0.48
53 0.5
54 0.47
55 0.47
56 0.43
57 0.39
58 0.4
59 0.35
60 0.33
61 0.3
62 0.32
63 0.34
64 0.31
65 0.3
66 0.29
67 0.3
68 0.31
69 0.31
70 0.35
71 0.31
72 0.4
73 0.4
74 0.43
75 0.41
76 0.39
77 0.38
78 0.29
79 0.28
80 0.22
81 0.21
82 0.17
83 0.17
84 0.15
85 0.15
86 0.16
87 0.12
88 0.12
89 0.15
90 0.14
91 0.16
92 0.19
93 0.22
94 0.22
95 0.26
96 0.24