Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A066WID4

Protein Details
Accession A0A066WID4    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
88-109LPPKLRAKPPVQRKFPCRCRPVHydrophilic
NLS Segment(s)
PositionSequence
89-95PPKLRAK
Subcellular Location(s) mito 18, nucl 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011032  GroES-like_sf  
Amino Acid Sequences MSTIPEQMKAACPTNVKKPMGVKAIPATKGRKDSELLLKIVAAGWCHTDIHVSEDSNEAMKKVGDELGSSFYDTSPGVGRRNQRQSRLPPKLRAKPPVQRKFPCRCRPVFIQQIGGSSLRFKVQEATHPRQADLHTM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.51
3 0.46
4 0.46
5 0.48
6 0.51
7 0.53
8 0.49
9 0.43
10 0.42
11 0.47
12 0.46
13 0.46
14 0.43
15 0.42
16 0.48
17 0.46
18 0.41
19 0.37
20 0.39
21 0.43
22 0.43
23 0.38
24 0.31
25 0.29
26 0.26
27 0.26
28 0.21
29 0.12
30 0.08
31 0.09
32 0.1
33 0.1
34 0.1
35 0.09
36 0.09
37 0.12
38 0.13
39 0.12
40 0.12
41 0.13
42 0.13
43 0.13
44 0.13
45 0.09
46 0.08
47 0.08
48 0.07
49 0.07
50 0.08
51 0.07
52 0.07
53 0.08
54 0.11
55 0.11
56 0.11
57 0.1
58 0.08
59 0.09
60 0.09
61 0.08
62 0.08
63 0.1
64 0.12
65 0.16
66 0.21
67 0.29
68 0.4
69 0.43
70 0.46
71 0.52
72 0.6
73 0.68
74 0.74
75 0.72
76 0.7
77 0.76
78 0.79
79 0.79
80 0.76
81 0.73
82 0.72
83 0.77
84 0.77
85 0.77
86 0.75
87 0.77
88 0.8
89 0.83
90 0.84
91 0.8
92 0.74
93 0.71
94 0.71
95 0.72
96 0.7
97 0.62
98 0.59
99 0.52
100 0.5
101 0.46
102 0.39
103 0.3
104 0.22
105 0.2
106 0.16
107 0.15
108 0.14
109 0.19
110 0.2
111 0.3
112 0.37
113 0.44
114 0.49
115 0.5
116 0.5
117 0.48