Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B5RSK4

Protein Details
Accession B5RSK4   
Localization Confidence High
Confidence Score 20.8
NoLS Segment(s)
PositionSequenceProtein Nature
10-31EIISAAPKRSNRKNRRGASAAGHydrophilic
41-64AAPKAGTPKNKQQKQQQQKKVAAIHydrophilic
181-216AAAKAKQQQQQQQKKKATKPKPKKAPKKTVEQLDAEHydrophilic
NLS Segment(s)
PositionSequence
16-33PKRSNRKNRRGASAAGNG
43-44PK
193-208QKKKATKPKPKKAPKK
Subcellular Location(s) nucl 13.5, mito_nucl 10, cyto 7, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
IPR034357  Yra1/Mlo3_RRM  
Gene Ontology GO:0005634  C:nucleus  
GO:0000346  C:transcription export complex  
GO:0003729  F:mRNA binding  
GO:1990119  F:RNA helicase inhibitor activity  
GO:0006406  P:mRNA export from nucleus  
GO:0006283  P:transcription-coupled nucleotide-excision repair  
KEGG yli:YALI0A20867g  -  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd12267  RRM_YRA1_MLO3  
Amino Acid Sequences MSNLDQSLDEIISAAPKRSNRKNRRGASAAGNGGVQKATPAAPKAGTPKNKQQKQQQQKKVAAIVNPIDEAKKLASKVIISNLPQDIGEDAIRDYFKTEIGPISACTMVYNKGGHPAGIVNVTFKRQGDAAKAADKFNGTSIDRGKRYMKVELVYDPSKTPLSARLQPKPEPAPAKATVNAAAKAKQQQQQQQKKKATKPKPKKAPKKTVEQLDAEMADYFQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.24
4 0.33
5 0.43
6 0.54
7 0.6
8 0.7
9 0.78
10 0.81
11 0.85
12 0.81
13 0.75
14 0.71
15 0.68
16 0.59
17 0.49
18 0.43
19 0.33
20 0.29
21 0.24
22 0.16
23 0.08
24 0.08
25 0.09
26 0.11
27 0.13
28 0.14
29 0.15
30 0.18
31 0.25
32 0.32
33 0.39
34 0.42
35 0.51
36 0.6
37 0.66
38 0.71
39 0.75
40 0.77
41 0.81
42 0.85
43 0.85
44 0.83
45 0.82
46 0.79
47 0.75
48 0.66
49 0.57
50 0.51
51 0.43
52 0.34
53 0.29
54 0.25
55 0.19
56 0.16
57 0.15
58 0.12
59 0.12
60 0.11
61 0.12
62 0.13
63 0.14
64 0.15
65 0.18
66 0.2
67 0.18
68 0.21
69 0.2
70 0.19
71 0.17
72 0.16
73 0.12
74 0.1
75 0.09
76 0.07
77 0.07
78 0.08
79 0.08
80 0.08
81 0.08
82 0.07
83 0.07
84 0.07
85 0.08
86 0.07
87 0.08
88 0.08
89 0.08
90 0.09
91 0.09
92 0.08
93 0.08
94 0.08
95 0.09
96 0.1
97 0.1
98 0.08
99 0.13
100 0.13
101 0.12
102 0.12
103 0.11
104 0.1
105 0.11
106 0.11
107 0.08
108 0.08
109 0.1
110 0.11
111 0.1
112 0.1
113 0.1
114 0.12
115 0.13
116 0.17
117 0.18
118 0.22
119 0.23
120 0.22
121 0.22
122 0.21
123 0.18
124 0.16
125 0.18
126 0.14
127 0.16
128 0.21
129 0.27
130 0.27
131 0.3
132 0.31
133 0.32
134 0.34
135 0.36
136 0.34
137 0.29
138 0.3
139 0.3
140 0.33
141 0.29
142 0.27
143 0.23
144 0.22
145 0.21
146 0.19
147 0.17
148 0.18
149 0.23
150 0.3
151 0.36
152 0.42
153 0.46
154 0.49
155 0.55
156 0.52
157 0.53
158 0.5
159 0.45
160 0.44
161 0.42
162 0.42
163 0.38
164 0.35
165 0.34
166 0.33
167 0.33
168 0.29
169 0.28
170 0.28
171 0.33
172 0.38
173 0.38
174 0.42
175 0.49
176 0.58
177 0.67
178 0.73
179 0.77
180 0.8
181 0.84
182 0.86
183 0.88
184 0.88
185 0.88
186 0.89
187 0.9
188 0.92
189 0.94
190 0.95
191 0.95
192 0.96
193 0.91
194 0.91
195 0.89
196 0.88
197 0.83
198 0.75
199 0.67
200 0.6
201 0.54
202 0.44
203 0.35