Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A066W1L6

Protein Details
Accession A0A066W1L6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
93-114GHVNHLKARKPRNSKAKIMLFGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_mito 10.166, mito 10, cyto 10, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023485  Ptyr_pPase  
IPR036196  Ptyr_pPase_sf  
IPR017867  Tyr_phospatase_low_mol_wt  
Gene Ontology GO:0003993  F:acid phosphatase activity  
GO:0004725  F:protein tyrosine phosphatase activity  
GO:0006470  P:protein dephosphorylation  
Pfam View protein in Pfam  
PF01451  LMWPc  
CDD cd16343  LMWPTP  
Amino Acid Sequences MAPVSVLFACTGNICRSPMAEAVFADLVKRNGLESSFGKIDSCGTIGYHVGEEADERTLAVCNRKGIPCVSRARRLKERDFEEFDYIFGMDSGHVNHLKARKPRNSKAKIMLFGDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.17
4 0.19
5 0.2
6 0.2
7 0.18
8 0.16
9 0.18
10 0.18
11 0.17
12 0.15
13 0.15
14 0.13
15 0.12
16 0.13
17 0.1
18 0.1
19 0.11
20 0.14
21 0.13
22 0.17
23 0.17
24 0.17
25 0.17
26 0.16
27 0.16
28 0.13
29 0.12
30 0.08
31 0.07
32 0.08
33 0.08
34 0.08
35 0.07
36 0.06
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.04
44 0.05
45 0.06
46 0.07
47 0.1
48 0.11
49 0.13
50 0.16
51 0.17
52 0.18
53 0.19
54 0.2
55 0.24
56 0.31
57 0.34
58 0.41
59 0.46
60 0.52
61 0.58
62 0.63
63 0.65
64 0.64
65 0.64
66 0.62
67 0.63
68 0.59
69 0.55
70 0.48
71 0.4
72 0.32
73 0.27
74 0.19
75 0.13
76 0.1
77 0.06
78 0.06
79 0.08
80 0.1
81 0.11
82 0.12
83 0.16
84 0.21
85 0.29
86 0.36
87 0.45
88 0.51
89 0.6
90 0.7
91 0.77
92 0.79
93 0.8
94 0.82
95 0.81
96 0.78