Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A066W171

Protein Details
Accession A0A066W171    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAKKGFAGHKERKRGKKKSKVVAELTVBasic
NLS Segment(s)
PositionSequence
3-20KKGFAGHKERKRGKKKSK
Subcellular Location(s) cyto_nucl 10.166, nucl 9.5, cyto 9.5, cyto_mito 9.333, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR040000  NOP9  
Gene Ontology GO:0003723  F:RNA binding  
Amino Acid Sequences MAKKGFAGHKERKRGKKKSKVVAELTVAAVEEPSESIIDTDLTKKPAAQQEGEDTDGQLNPSWVVSESSIKPNDADDVAPFGYVDADVKAYFKDVHAKLKEAEWAAPQKNRSSELGEDIDGENEHSLLLNAAIREMDGKELRLATDPDTSIALEYIIEHMKEKQMRILVDRMTGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.9
3 0.9
4 0.91
5 0.91
6 0.92
7 0.9
8 0.85
9 0.8
10 0.72
11 0.63
12 0.53
13 0.42
14 0.32
15 0.22
16 0.16
17 0.1
18 0.07
19 0.05
20 0.05
21 0.05
22 0.05
23 0.05
24 0.06
25 0.06
26 0.07
27 0.11
28 0.13
29 0.15
30 0.15
31 0.15
32 0.21
33 0.26
34 0.29
35 0.27
36 0.27
37 0.3
38 0.33
39 0.34
40 0.29
41 0.22
42 0.2
43 0.19
44 0.17
45 0.12
46 0.09
47 0.07
48 0.07
49 0.07
50 0.07
51 0.07
52 0.08
53 0.11
54 0.13
55 0.18
56 0.19
57 0.19
58 0.18
59 0.17
60 0.18
61 0.14
62 0.13
63 0.08
64 0.09
65 0.09
66 0.09
67 0.08
68 0.07
69 0.06
70 0.06
71 0.06
72 0.03
73 0.04
74 0.04
75 0.05
76 0.05
77 0.06
78 0.06
79 0.06
80 0.14
81 0.15
82 0.23
83 0.24
84 0.26
85 0.25
86 0.26
87 0.29
88 0.22
89 0.22
90 0.17
91 0.22
92 0.23
93 0.26
94 0.26
95 0.26
96 0.28
97 0.29
98 0.27
99 0.25
100 0.23
101 0.24
102 0.24
103 0.21
104 0.21
105 0.19
106 0.17
107 0.14
108 0.13
109 0.09
110 0.07
111 0.07
112 0.05
113 0.05
114 0.04
115 0.05
116 0.06
117 0.06
118 0.06
119 0.06
120 0.06
121 0.07
122 0.08
123 0.12
124 0.11
125 0.13
126 0.14
127 0.15
128 0.16
129 0.17
130 0.18
131 0.16
132 0.19
133 0.19
134 0.18
135 0.18
136 0.18
137 0.15
138 0.14
139 0.11
140 0.07
141 0.07
142 0.09
143 0.11
144 0.11
145 0.12
146 0.13
147 0.21
148 0.25
149 0.25
150 0.28
151 0.31
152 0.33
153 0.36
154 0.41
155 0.36