Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A066VKG8

Protein Details
Accession A0A066VKG8    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
54-74ERTAKHVQKGKERRRKTEEIWBasic
NLS Segment(s)
PositionSequence
54-69ERTAKHVQKGKERRRK
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MHPHLSNDSKQLACASIIQALEDCHKQGLMTKMSGKCNPIKDELIQCLRKERLERTAKHVQKGKERRRKTEEIWREIDGDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.17
3 0.15
4 0.15
5 0.14
6 0.13
7 0.13
8 0.15
9 0.14
10 0.14
11 0.1
12 0.1
13 0.1
14 0.14
15 0.18
16 0.18
17 0.19
18 0.25
19 0.28
20 0.33
21 0.34
22 0.33
23 0.32
24 0.34
25 0.35
26 0.31
27 0.29
28 0.27
29 0.28
30 0.3
31 0.33
32 0.31
33 0.29
34 0.31
35 0.31
36 0.32
37 0.32
38 0.31
39 0.34
40 0.4
41 0.42
42 0.44
43 0.53
44 0.55
45 0.59
46 0.62
47 0.57
48 0.6
49 0.69
50 0.72
51 0.72
52 0.76
53 0.79
54 0.81
55 0.83
56 0.79
57 0.8
58 0.79
59 0.76
60 0.73
61 0.65