Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A066VK75

Protein Details
Accession A0A066VK75    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
186-215MQDKAERRAQKSRREPERDGKRVRTFKQRABasic
NLS Segment(s)
PositionSequence
188-213DKAERRAQKSRREPERDGKRVRTFKQ
Subcellular Location(s) mito 12, nucl 11, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039119  ABT1/Esf2  
IPR034353  ABT1/ESF2_RRM  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:0003676  F:nucleic acid binding  
CDD cd12263  RRM_ABT1_like  
Amino Acid Sequences VLKPLSKEDLERFERKQRKKGVIYISHLPHGMTVPKVKHLLGSFGEVERIFLQDGTLRAGEKRESLSFTRSCKRTTAHFTEGWVEFSSKRIAKTVAEMLNAQPIGAAAVTRSSMRSKNGPGKGRNSKRFKDDVWTMKYLPGYKWHMLTEQLANERASRTARLRTELSQSAFEQKDYLRKVERARIMQDKAERRAQKSRREPERDGKRVRTFKQRAPVFKDVRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.67
3 0.7
4 0.7
5 0.74
6 0.75
7 0.78
8 0.78
9 0.77
10 0.75
11 0.74
12 0.68
13 0.6
14 0.53
15 0.45
16 0.35
17 0.29
18 0.25
19 0.2
20 0.23
21 0.22
22 0.26
23 0.28
24 0.27
25 0.29
26 0.28
27 0.29
28 0.25
29 0.27
30 0.24
31 0.22
32 0.24
33 0.2
34 0.2
35 0.16
36 0.15
37 0.12
38 0.1
39 0.1
40 0.1
41 0.11
42 0.13
43 0.13
44 0.12
45 0.12
46 0.15
47 0.15
48 0.14
49 0.17
50 0.16
51 0.19
52 0.21
53 0.26
54 0.28
55 0.33
56 0.39
57 0.38
58 0.38
59 0.37
60 0.37
61 0.39
62 0.43
63 0.46
64 0.42
65 0.41
66 0.41
67 0.42
68 0.4
69 0.35
70 0.27
71 0.2
72 0.15
73 0.16
74 0.2
75 0.17
76 0.17
77 0.17
78 0.17
79 0.16
80 0.2
81 0.24
82 0.21
83 0.21
84 0.21
85 0.19
86 0.21
87 0.2
88 0.17
89 0.1
90 0.08
91 0.07
92 0.06
93 0.06
94 0.02
95 0.03
96 0.04
97 0.04
98 0.06
99 0.07
100 0.09
101 0.12
102 0.15
103 0.2
104 0.28
105 0.35
106 0.41
107 0.42
108 0.49
109 0.58
110 0.64
111 0.69
112 0.68
113 0.64
114 0.64
115 0.64
116 0.56
117 0.52
118 0.5
119 0.49
120 0.46
121 0.46
122 0.4
123 0.39
124 0.4
125 0.34
126 0.28
127 0.26
128 0.27
129 0.26
130 0.27
131 0.26
132 0.25
133 0.25
134 0.27
135 0.23
136 0.2
137 0.21
138 0.21
139 0.21
140 0.2
141 0.19
142 0.19
143 0.18
144 0.18
145 0.19
146 0.25
147 0.26
148 0.3
149 0.32
150 0.33
151 0.37
152 0.39
153 0.38
154 0.33
155 0.32
156 0.36
157 0.33
158 0.31
159 0.26
160 0.22
161 0.28
162 0.28
163 0.31
164 0.29
165 0.33
166 0.39
167 0.45
168 0.51
169 0.49
170 0.53
171 0.57
172 0.55
173 0.56
174 0.59
175 0.58
176 0.56
177 0.6
178 0.59
179 0.56
180 0.64
181 0.65
182 0.68
183 0.71
184 0.76
185 0.77
186 0.81
187 0.82
188 0.83
189 0.86
190 0.85
191 0.83
192 0.82
193 0.82
194 0.82
195 0.81
196 0.82
197 0.78
198 0.76
199 0.78
200 0.77
201 0.75
202 0.75
203 0.79