Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A066VDC2

Protein Details
Accession A0A066VDC2    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MLSRRTRGPRKGTGRPHLRTKGBasic
NLS Segment(s)
PositionSequence
7-16RGPRKGTGRP
Subcellular Location(s) mito 23, nucl 4
Family & Domain DBs
Amino Acid Sequences MLSRRTRGPRKGTGRPHLRTKGELIAEGLTDRSAALMGFLGPFCIGLGEPIVLDINLHIGLVYEHIRSSSCFLRHLRLRQHVLYEYSKSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.8
3 0.81
4 0.79
5 0.74
6 0.66
7 0.6
8 0.56
9 0.47
10 0.41
11 0.33
12 0.25
13 0.22
14 0.19
15 0.15
16 0.08
17 0.07
18 0.06
19 0.05
20 0.04
21 0.04
22 0.04
23 0.03
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.03
33 0.03
34 0.04
35 0.03
36 0.03
37 0.04
38 0.04
39 0.04
40 0.04
41 0.03
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.06
49 0.07
50 0.07
51 0.07
52 0.07
53 0.08
54 0.09
55 0.13
56 0.17
57 0.18
58 0.23
59 0.25
60 0.33
61 0.41
62 0.48
63 0.54
64 0.57
65 0.62
66 0.6
67 0.63
68 0.59
69 0.57
70 0.53