Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A066WKK3

Protein Details
Accession A0A066WKK3    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
34-59LASATKTSKKKKWSKGKVKDKAQNSVHydrophilic
NLS Segment(s)
PositionSequence
37-53ATKTSKKKKWSKGKVKD
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MHAASMPIPQSLFQIIEYLLSRSPTVPPKKAAILASATKTSKKKKWSKGKVKDKAQNSVVLDKPTYDKILKEVPTFKMISQSTLIDRLKVNGSLARRAIRHLEKEGQIKRIIHHHGQLVYTRASGSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.14
4 0.14
5 0.14
6 0.14
7 0.14
8 0.14
9 0.14
10 0.19
11 0.25
12 0.32
13 0.34
14 0.36
15 0.38
16 0.4
17 0.43
18 0.39
19 0.33
20 0.3
21 0.29
22 0.29
23 0.29
24 0.27
25 0.28
26 0.33
27 0.38
28 0.39
29 0.47
30 0.54
31 0.61
32 0.71
33 0.77
34 0.83
35 0.86
36 0.92
37 0.91
38 0.91
39 0.88
40 0.81
41 0.77
42 0.67
43 0.61
44 0.51
45 0.47
46 0.39
47 0.32
48 0.28
49 0.21
50 0.21
51 0.17
52 0.18
53 0.13
54 0.12
55 0.13
56 0.19
57 0.2
58 0.22
59 0.24
60 0.23
61 0.26
62 0.27
63 0.24
64 0.26
65 0.24
66 0.23
67 0.21
68 0.21
69 0.19
70 0.25
71 0.25
72 0.19
73 0.19
74 0.19
75 0.2
76 0.19
77 0.19
78 0.16
79 0.18
80 0.21
81 0.24
82 0.26
83 0.24
84 0.26
85 0.33
86 0.36
87 0.38
88 0.39
89 0.43
90 0.45
91 0.53
92 0.55
93 0.52
94 0.5
95 0.47
96 0.44
97 0.45
98 0.46
99 0.42
100 0.42
101 0.43
102 0.41
103 0.42
104 0.42
105 0.38
106 0.32
107 0.28