Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A066W7K8

Protein Details
Accession A0A066W7K8    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-33VNVPKTRRTYCKGKTCKKHTPHKVTQYKTGKAHydrophilic
NLS Segment(s)
PositionSequence
39-63GKRRYDRKQKGYGGQTKPVFHKKAK
Subcellular Location(s) nucl 16, cyto 7, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRRTYCKGKTCKKHTPHKVTQYKTGKASLAAQGKRRYDRKQKGYGGQTKPVFHKKAKTTKKVVLRLECTACKYRSHAALKRCKHFELGGDKKQKGAALSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.85
4 0.89
5 0.87
6 0.89
7 0.89
8 0.88
9 0.88
10 0.88
11 0.88
12 0.82
13 0.83
14 0.8
15 0.74
16 0.66
17 0.59
18 0.48
19 0.4
20 0.39
21 0.35
22 0.35
23 0.33
24 0.37
25 0.4
26 0.44
27 0.49
28 0.52
29 0.54
30 0.57
31 0.63
32 0.65
33 0.69
34 0.7
35 0.7
36 0.73
37 0.74
38 0.66
39 0.64
40 0.58
41 0.51
42 0.5
43 0.5
44 0.45
45 0.38
46 0.42
47 0.43
48 0.51
49 0.58
50 0.61
51 0.61
52 0.64
53 0.71
54 0.72
55 0.7
56 0.67
57 0.62
58 0.59
59 0.57
60 0.52
61 0.48
62 0.45
63 0.4
64 0.34
65 0.34
66 0.34
67 0.38
68 0.44
69 0.46
70 0.49
71 0.58
72 0.65
73 0.7
74 0.69
75 0.62
76 0.57
77 0.53
78 0.51
79 0.52
80 0.53
81 0.54
82 0.58
83 0.56
84 0.55
85 0.55
86 0.5