Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A066VF27

Protein Details
Accession A0A066VF27    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
73-97FSKRYLKYLTKKHLKRNQLRDWLRVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 16.5, cyto_nucl 9, mito 6, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002671  Ribosomal_L22e  
IPR038526  Ribosomal_L22e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01776  Ribosomal_L22e  
Amino Acid Sequences MAPAKTSKVAPKGEKYFIDFSGPANDGILDAAAFEKFLHDRIKVDGKAGQLGDVVTITREGEGKIWVNTTIPFSKRYLKYLTKKHLKRNQLRDWLRVVATSKQGFEIKFFNVSPDQDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.56
3 0.52
4 0.45
5 0.44
6 0.35
7 0.3
8 0.29
9 0.28
10 0.22
11 0.19
12 0.18
13 0.13
14 0.13
15 0.11
16 0.05
17 0.04
18 0.05
19 0.04
20 0.04
21 0.04
22 0.06
23 0.06
24 0.09
25 0.11
26 0.12
27 0.13
28 0.17
29 0.24
30 0.23
31 0.24
32 0.24
33 0.22
34 0.25
35 0.23
36 0.19
37 0.13
38 0.12
39 0.11
40 0.08
41 0.07
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.05
48 0.05
49 0.07
50 0.08
51 0.08
52 0.09
53 0.09
54 0.09
55 0.1
56 0.12
57 0.15
58 0.15
59 0.16
60 0.18
61 0.27
62 0.28
63 0.31
64 0.35
65 0.4
66 0.47
67 0.55
68 0.63
69 0.65
70 0.7
71 0.77
72 0.79
73 0.8
74 0.82
75 0.83
76 0.83
77 0.83
78 0.81
79 0.74
80 0.7
81 0.63
82 0.53
83 0.46
84 0.39
85 0.32
86 0.36
87 0.33
88 0.29
89 0.29
90 0.32
91 0.29
92 0.29
93 0.28
94 0.23
95 0.25
96 0.25
97 0.25
98 0.26
99 0.27