Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A066WG61

Protein Details
Accession A0A066WG61    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MDDLQLRPRKSRKVGKFAPRGIYHydrophilic
NLS Segment(s)
PositionSequence
9-13RKSRK
Subcellular Location(s) mito 12.5, mito_nucl 10.333, nucl 7, cyto_nucl 6.666, cyto 5, cyto_pero 4.333
Family & Domain DBs
Gene Ontology GO:0016787  F:hydrolase activity  
Amino Acid Sequences MDDLQLRPRKSRKVGKFAPRGIYIPSIDPNVYLDNDNIKIYLYLSRNAYQNWKAQLLGGELKAGWWHNPTANALMEIVDKMKNANLANVPAVPANMSTYSGNGEIHEPPHKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.83
3 0.86
4 0.83
5 0.79
6 0.72
7 0.63
8 0.55
9 0.49
10 0.4
11 0.32
12 0.28
13 0.24
14 0.2
15 0.19
16 0.18
17 0.16
18 0.16
19 0.14
20 0.13
21 0.14
22 0.15
23 0.15
24 0.13
25 0.12
26 0.11
27 0.11
28 0.16
29 0.14
30 0.15
31 0.18
32 0.2
33 0.21
34 0.22
35 0.26
36 0.24
37 0.26
38 0.26
39 0.24
40 0.22
41 0.21
42 0.21
43 0.18
44 0.17
45 0.12
46 0.1
47 0.09
48 0.09
49 0.09
50 0.09
51 0.07
52 0.07
53 0.08
54 0.09
55 0.11
56 0.12
57 0.14
58 0.14
59 0.13
60 0.12
61 0.11
62 0.11
63 0.1
64 0.1
65 0.08
66 0.07
67 0.08
68 0.09
69 0.12
70 0.12
71 0.15
72 0.16
73 0.17
74 0.19
75 0.19
76 0.18
77 0.15
78 0.14
79 0.11
80 0.1
81 0.1
82 0.1
83 0.12
84 0.11
85 0.12
86 0.14
87 0.15
88 0.15
89 0.13
90 0.15
91 0.15
92 0.19