Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A066VL24

Protein Details
Accession A0A066VL24    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
36-56DGMPSSRRRRRNTKSTSRTFWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_mito 5, mito 4.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
IPR043128  Rev_trsase/Diguanyl_cyclase  
Amino Acid Sequences WAVMPMGLTNSPTTFQGMVNCILGAMIDRTCRVYLDGMPSSRRRRRNTKSTSRTFWPGYVCTGWSLGKSGSCSANSFTSLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.16
4 0.17
5 0.17
6 0.17
7 0.16
8 0.13
9 0.12
10 0.1
11 0.08
12 0.07
13 0.06
14 0.07
15 0.07
16 0.09
17 0.09
18 0.1
19 0.1
20 0.1
21 0.11
22 0.16
23 0.18
24 0.18
25 0.21
26 0.27
27 0.35
28 0.4
29 0.47
30 0.48
31 0.55
32 0.63
33 0.7
34 0.75
35 0.78
36 0.81
37 0.81
38 0.79
39 0.73
40 0.7
41 0.62
42 0.54
43 0.46
44 0.37
45 0.34
46 0.29
47 0.25
48 0.2
49 0.2
50 0.18
51 0.15
52 0.16
53 0.13
54 0.14
55 0.16
56 0.18
57 0.19
58 0.2
59 0.22
60 0.23
61 0.24