Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A066VIL5

Protein Details
Accession A0A066VIL5    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
27-49GIALHRPGHNRLRRQNRPPISCAHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 13, cyto 8, mito 3, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036188  FAD/NAD-bd_sf  
Gene Ontology GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
Amino Acid Sequences MGTSAAPTFQPLTVCIIGRGIGDLAAGIALHRPGHNRLRRQNRPPISCAANGVRWPREWGVDCIAGRRVTLMKLIMHDWNTGEVLNEYNLSGNEAEFHRRDQHRILLEAAASPEDSEYSTVTFQNGATFRRTDLIVGADGIHSVVREQIGMQVIKRSAAQSCYRCNFTKQEAEHPCTGGDVISLYLFMPSELTNHHAEGFSWADATVEECIPGLYSQLDPRCRQLIQHTIERKPWGLYIHEPYSHWQHGRACLLGDPVKPLMPNQSQGARKYDGRFTSDVQASLQVYETIRSPRGSRVQLASLKATMNINERIGFFRLSSHDARLAAPEGKLTVDEMNRYDMHQHIEDVVSALDAVGEVHEQGKTTQVHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.2
4 0.19
5 0.18
6 0.18
7 0.12
8 0.09
9 0.08
10 0.07
11 0.07
12 0.06
13 0.05
14 0.04
15 0.06
16 0.07
17 0.08
18 0.1
19 0.14
20 0.21
21 0.32
22 0.4
23 0.49
24 0.58
25 0.68
26 0.76
27 0.82
28 0.86
29 0.86
30 0.84
31 0.78
32 0.74
33 0.68
34 0.59
35 0.56
36 0.49
37 0.44
38 0.42
39 0.44
40 0.4
41 0.36
42 0.39
43 0.35
44 0.37
45 0.36
46 0.35
47 0.34
48 0.36
49 0.35
50 0.34
51 0.36
52 0.3
53 0.27
54 0.25
55 0.22
56 0.17
57 0.2
58 0.2
59 0.17
60 0.19
61 0.21
62 0.23
63 0.23
64 0.23
65 0.21
66 0.19
67 0.18
68 0.16
69 0.15
70 0.11
71 0.1
72 0.1
73 0.1
74 0.08
75 0.09
76 0.09
77 0.1
78 0.09
79 0.08
80 0.1
81 0.11
82 0.16
83 0.15
84 0.18
85 0.25
86 0.27
87 0.31
88 0.33
89 0.38
90 0.36
91 0.37
92 0.36
93 0.29
94 0.27
95 0.24
96 0.21
97 0.14
98 0.11
99 0.09
100 0.08
101 0.07
102 0.07
103 0.06
104 0.06
105 0.07
106 0.08
107 0.09
108 0.09
109 0.09
110 0.09
111 0.13
112 0.15
113 0.15
114 0.16
115 0.17
116 0.17
117 0.18
118 0.18
119 0.13
120 0.13
121 0.12
122 0.1
123 0.1
124 0.1
125 0.08
126 0.07
127 0.07
128 0.06
129 0.04
130 0.04
131 0.05
132 0.04
133 0.05
134 0.05
135 0.07
136 0.1
137 0.11
138 0.11
139 0.14
140 0.14
141 0.14
142 0.15
143 0.13
144 0.12
145 0.15
146 0.21
147 0.22
148 0.28
149 0.3
150 0.34
151 0.34
152 0.36
153 0.36
154 0.34
155 0.37
156 0.32
157 0.39
158 0.41
159 0.43
160 0.41
161 0.38
162 0.33
163 0.26
164 0.25
165 0.14
166 0.09
167 0.05
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.04
175 0.04
176 0.04
177 0.05
178 0.05
179 0.08
180 0.09
181 0.09
182 0.1
183 0.1
184 0.1
185 0.12
186 0.12
187 0.09
188 0.08
189 0.08
190 0.07
191 0.07
192 0.08
193 0.07
194 0.05
195 0.05
196 0.05
197 0.05
198 0.05
199 0.05
200 0.05
201 0.05
202 0.06
203 0.1
204 0.15
205 0.19
206 0.19
207 0.22
208 0.25
209 0.24
210 0.25
211 0.27
212 0.31
213 0.32
214 0.39
215 0.42
216 0.42
217 0.45
218 0.46
219 0.41
220 0.33
221 0.31
222 0.24
223 0.21
224 0.23
225 0.26
226 0.27
227 0.28
228 0.27
229 0.28
230 0.32
231 0.33
232 0.29
233 0.27
234 0.27
235 0.3
236 0.32
237 0.3
238 0.24
239 0.21
240 0.25
241 0.24
242 0.22
243 0.19
244 0.18
245 0.18
246 0.18
247 0.17
248 0.21
249 0.2
250 0.22
251 0.23
252 0.29
253 0.32
254 0.35
255 0.39
256 0.35
257 0.36
258 0.37
259 0.41
260 0.37
261 0.38
262 0.37
263 0.35
264 0.39
265 0.37
266 0.34
267 0.28
268 0.28
269 0.23
270 0.22
271 0.2
272 0.14
273 0.12
274 0.13
275 0.14
276 0.15
277 0.17
278 0.18
279 0.19
280 0.25
281 0.32
282 0.35
283 0.37
284 0.37
285 0.42
286 0.45
287 0.46
288 0.41
289 0.35
290 0.33
291 0.3
292 0.27
293 0.23
294 0.23
295 0.24
296 0.23
297 0.23
298 0.23
299 0.25
300 0.25
301 0.23
302 0.18
303 0.19
304 0.21
305 0.25
306 0.26
307 0.26
308 0.28
309 0.28
310 0.28
311 0.28
312 0.28
313 0.25
314 0.23
315 0.2
316 0.17
317 0.17
318 0.16
319 0.15
320 0.16
321 0.16
322 0.19
323 0.19
324 0.23
325 0.23
326 0.24
327 0.25
328 0.23
329 0.26
330 0.24
331 0.24
332 0.21
333 0.22
334 0.21
335 0.19
336 0.17
337 0.11
338 0.1
339 0.08
340 0.06
341 0.05
342 0.05
343 0.05
344 0.05
345 0.05
346 0.07
347 0.08
348 0.09
349 0.09
350 0.16