Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A066WLC3

Protein Details
Accession A0A066WLC3    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
28-51RMKTDNKIQYNKNRRHWRRTKLNLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 14, nucl 13.5, mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR020083  Ribosomal_L39_CS  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
PROSITE View protein in PROSITE  
PS00051  RIBOSOMAL_L39E  
Amino Acid Sequences MPSQKTFRTKVRLAKASRQNRPIPNWFRMKTDNKIQYNKNRRHWRRTKLNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.74
3 0.75
4 0.76
5 0.74
6 0.71
7 0.69
8 0.69
9 0.69
10 0.64
11 0.61
12 0.61
13 0.55
14 0.51
15 0.53
16 0.52
17 0.48
18 0.52
19 0.55
20 0.53
21 0.59
22 0.62
23 0.66
24 0.71
25 0.75
26 0.76
27 0.78
28 0.81
29 0.85
30 0.88
31 0.88