Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A066VJN9

Protein Details
Accession A0A066VJN9    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MKINKLKVRPKKEVRTAACAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MKINKLKVRPKKEVRTAACAAEFATMLACWASYNDLSSQGQCAESARALQACMRTKAKKQAVSKPTINYHLARFSKQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.73
4 0.65
5 0.55
6 0.44
7 0.35
8 0.25
9 0.2
10 0.12
11 0.1
12 0.06
13 0.06
14 0.05
15 0.05
16 0.04
17 0.04
18 0.06
19 0.05
20 0.07
21 0.07
22 0.1
23 0.1
24 0.1
25 0.11
26 0.1
27 0.1
28 0.09
29 0.09
30 0.07
31 0.07
32 0.08
33 0.08
34 0.08
35 0.08
36 0.1
37 0.15
38 0.18
39 0.23
40 0.28
41 0.31
42 0.36
43 0.46
44 0.52
45 0.54
46 0.57
47 0.63
48 0.65
49 0.69
50 0.69
51 0.65
52 0.63
53 0.6
54 0.57
55 0.49
56 0.45
57 0.47
58 0.45