Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A066WF62

Protein Details
Accession A0A066WF62    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
31-67GSEYQPSQRKRKRKHGFLSRLRTKKGRQLLAKRRMAGHydrophilic
NLS Segment(s)
PositionSequence
39-69RKRKRKHGFLSRLRTKKGRQLLAKRRMAGRR
Subcellular Location(s) nucl 16, cyto_nucl 10.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MSTHSFLRTTPFPSLRQSHPQSQQARCVTYGSEYQPSQRKRKRKHGFLSRLRTKKGRQLLAKRRMAGRRFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.44
3 0.5
4 0.52
5 0.52
6 0.56
7 0.62
8 0.62
9 0.6
10 0.63
11 0.56
12 0.52
13 0.44
14 0.38
15 0.3
16 0.25
17 0.25
18 0.19
19 0.19
20 0.18
21 0.22
22 0.28
23 0.33
24 0.41
25 0.45
26 0.53
27 0.58
28 0.69
29 0.75
30 0.77
31 0.83
32 0.84
33 0.88
34 0.88
35 0.9
36 0.89
37 0.85
38 0.8
39 0.75
40 0.69
41 0.67
42 0.66
43 0.64
44 0.64
45 0.69
46 0.75
47 0.79
48 0.82
49 0.77
50 0.76
51 0.76
52 0.69
53 0.68