Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6CFS7

Protein Details
Accession Q6CFS7    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-31IPKTRNTYCKGKECRKHTQHKVTQYKAGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG yli:YALI0B04224g  -  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRNTYCKGKECRKHTQHKVTQYKAGKASLYAQGKRRYDRKQSGYGGQTKQIFHKKAKTTKKVVLRLECVKCKVKMQLALKRCKHFELGGDKKQKGQALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.77
3 0.77
4 0.83
5 0.82
6 0.85
7 0.85
8 0.86
9 0.84
10 0.86
11 0.88
12 0.81
13 0.8
14 0.74
15 0.69
16 0.61
17 0.55
18 0.44
19 0.35
20 0.34
21 0.33
22 0.34
23 0.32
24 0.35
25 0.41
26 0.44
27 0.48
28 0.53
29 0.52
30 0.56
31 0.61
32 0.61
33 0.61
34 0.61
35 0.61
36 0.59
37 0.58
38 0.49
39 0.44
40 0.4
41 0.33
42 0.36
43 0.37
44 0.36
45 0.32
46 0.4
47 0.43
48 0.5
49 0.6
50 0.62
51 0.61
52 0.65
53 0.71
54 0.71
55 0.7
56 0.66
57 0.63
58 0.64
59 0.64
60 0.61
61 0.57
62 0.53
63 0.48
64 0.46
65 0.46
66 0.42
67 0.44
68 0.48
69 0.52
70 0.56
71 0.65
72 0.69
73 0.69
74 0.66
75 0.6
76 0.55
77 0.48
78 0.47
79 0.48
80 0.5
81 0.53
82 0.59
83 0.57
84 0.58
85 0.61
86 0.57