Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A066VYQ8

Protein Details
Accession A0A066VYQ8    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGKRKSSRKPQGSKKREPLETQBasic
NLS Segment(s)
PositionSequence
3-16KRKSSRKPQGSKKR
Subcellular Location(s) mito 16.5, mito_nucl 12.999, cyto_mito 10.666, nucl 8, cyto_nucl 5.999
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKSSRKPQGSKKREPLETQFTCLFCNHPKAVTCKIDTTARIGYLKCKVCGQEWSHDTDALSEPIDVYSLWIDACEEVNKEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.89
3 0.84
4 0.8
5 0.76
6 0.75
7 0.67
8 0.61
9 0.54
10 0.45
11 0.41
12 0.35
13 0.31
14 0.24
15 0.27
16 0.23
17 0.22
18 0.24
19 0.28
20 0.34
21 0.34
22 0.32
23 0.28
24 0.3
25 0.3
26 0.28
27 0.27
28 0.21
29 0.19
30 0.19
31 0.17
32 0.18
33 0.23
34 0.25
35 0.22
36 0.23
37 0.23
38 0.23
39 0.3
40 0.3
41 0.31
42 0.3
43 0.35
44 0.35
45 0.34
46 0.32
47 0.28
48 0.26
49 0.19
50 0.18
51 0.11
52 0.11
53 0.1
54 0.1
55 0.08
56 0.07
57 0.07
58 0.07
59 0.07
60 0.06
61 0.07
62 0.07
63 0.1
64 0.11