Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A066VP84

Protein Details
Accession A0A066VP84    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
65-90VLGYLVEKLRRRKKRRPSCAALALHNHydrophilic
NLS Segment(s)
PositionSequence
72-80KLRRRKKRR
Subcellular Location(s) mito 20.5, cyto_mito 11.833, nucl 3.5, cyto_nucl 3.333
Family & Domain DBs
Amino Acid Sequences MCKTLLAYLPLRQSVYHHLKFEFPSVLVPRPCMPTTRLLSSSTRGKVTWGHLLAGAGKGPGPGGVLGYLVEKLRRRKKRRPSCAALALHNSPTAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.4
3 0.4
4 0.38
5 0.36
6 0.39
7 0.4
8 0.4
9 0.32
10 0.23
11 0.23
12 0.24
13 0.29
14 0.26
15 0.27
16 0.26
17 0.29
18 0.29
19 0.26
20 0.25
21 0.26
22 0.29
23 0.32
24 0.31
25 0.29
26 0.3
27 0.32
28 0.36
29 0.3
30 0.28
31 0.23
32 0.23
33 0.23
34 0.24
35 0.26
36 0.2
37 0.19
38 0.18
39 0.18
40 0.18
41 0.15
42 0.12
43 0.06
44 0.06
45 0.05
46 0.05
47 0.05
48 0.05
49 0.04
50 0.04
51 0.05
52 0.05
53 0.05
54 0.06
55 0.07
56 0.07
57 0.11
58 0.16
59 0.26
60 0.36
61 0.47
62 0.55
63 0.65
64 0.76
65 0.83
66 0.89
67 0.9
68 0.88
69 0.87
70 0.87
71 0.81
72 0.76
73 0.71
74 0.63
75 0.54