Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6C6Y7

Protein Details
Accession Q6C6Y7    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MASDKKRKASSKRLTKIKVAKVQDHydrophilic
NLS Segment(s)
PositionSequence
5-16KKRKASSKRLTK
400-410ELAQRRRRAKK
Subcellular Location(s) nucl 11, cyto_nucl 9.5, mito 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009668  RNA_pol-assoc_fac_A49-like  
Gene Ontology GO:0005736  C:RNA polymerase I complex  
GO:0003677  F:DNA binding  
GO:0001054  F:RNA polymerase I activity  
GO:0001188  P:RNA polymerase I preinitiation complex assembly  
GO:0006363  P:termination of RNA polymerase I transcription  
GO:0006362  P:transcription elongation by RNA polymerase I  
KEGG yli:YALI0E05225g  -  
Pfam View protein in Pfam  
PF06870  RNA_pol_I_A49  
Amino Acid Sequences MASDKKRKASSKRLTKIKVAKVQDDGKVFLSDCGHLSIPKDAKFSSVSDNGETSIKGKSSRMRYTSVPVDHEKYCVAVISSKGLADLVPAESIELKAMSKQLAKRVAENTEQKSYREQRVNLGNEFGTLKAKKTLASLARNNIDSNELVDFEDDVVEAVATATANLPTQEQVSMAMDDARPIPKHNLETLDVNEIYPVEGYLTDEEAGYIRSEAILDEQDIGKRVDMLPYRTSQMVRDSLYKITDKTDETMYKTSLLYYLSLLIGFYRDRHVKKREDIKTRLNNPPEYLIDQMLYRYTTPLSGGHKSQRYHTYMVNSRNEAMLLCTIIILVLRLNNNVVDIPILSQEVGIKPSKLADVCRQVGCAIKNASLTHMDDIGRPRTEASHWKIASLKAPLKLPELAQRRRRAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.85
4 0.84
5 0.82
6 0.77
7 0.73
8 0.7
9 0.7
10 0.66
11 0.59
12 0.51
13 0.44
14 0.4
15 0.35
16 0.31
17 0.26
18 0.22
19 0.2
20 0.21
21 0.19
22 0.18
23 0.2
24 0.25
25 0.29
26 0.3
27 0.32
28 0.29
29 0.31
30 0.32
31 0.32
32 0.31
33 0.31
34 0.3
35 0.3
36 0.3
37 0.29
38 0.28
39 0.26
40 0.2
41 0.17
42 0.17
43 0.17
44 0.2
45 0.27
46 0.35
47 0.43
48 0.46
49 0.46
50 0.48
51 0.53
52 0.57
53 0.53
54 0.49
55 0.46
56 0.46
57 0.43
58 0.42
59 0.35
60 0.27
61 0.23
62 0.19
63 0.14
64 0.13
65 0.13
66 0.15
67 0.16
68 0.14
69 0.14
70 0.13
71 0.12
72 0.1
73 0.1
74 0.07
75 0.07
76 0.07
77 0.07
78 0.08
79 0.08
80 0.08
81 0.07
82 0.07
83 0.08
84 0.1
85 0.12
86 0.16
87 0.19
88 0.26
89 0.33
90 0.34
91 0.37
92 0.4
93 0.42
94 0.44
95 0.49
96 0.46
97 0.47
98 0.47
99 0.44
100 0.48
101 0.5
102 0.51
103 0.51
104 0.48
105 0.46
106 0.54
107 0.57
108 0.49
109 0.45
110 0.36
111 0.3
112 0.3
113 0.23
114 0.2
115 0.16
116 0.17
117 0.18
118 0.19
119 0.19
120 0.2
121 0.26
122 0.27
123 0.35
124 0.38
125 0.4
126 0.43
127 0.43
128 0.41
129 0.35
130 0.29
131 0.22
132 0.18
133 0.13
134 0.1
135 0.1
136 0.09
137 0.09
138 0.07
139 0.07
140 0.06
141 0.05
142 0.04
143 0.04
144 0.03
145 0.03
146 0.03
147 0.03
148 0.03
149 0.04
150 0.04
151 0.04
152 0.05
153 0.05
154 0.06
155 0.06
156 0.06
157 0.06
158 0.07
159 0.08
160 0.08
161 0.07
162 0.08
163 0.07
164 0.08
165 0.09
166 0.11
167 0.1
168 0.12
169 0.15
170 0.17
171 0.19
172 0.2
173 0.22
174 0.21
175 0.23
176 0.22
177 0.23
178 0.2
179 0.18
180 0.15
181 0.12
182 0.11
183 0.09
184 0.07
185 0.04
186 0.03
187 0.04
188 0.05
189 0.05
190 0.05
191 0.05
192 0.05
193 0.05
194 0.06
195 0.05
196 0.05
197 0.04
198 0.04
199 0.04
200 0.04
201 0.05
202 0.05
203 0.05
204 0.06
205 0.07
206 0.07
207 0.09
208 0.09
209 0.08
210 0.08
211 0.08
212 0.12
213 0.14
214 0.17
215 0.18
216 0.19
217 0.21
218 0.21
219 0.22
220 0.18
221 0.2
222 0.2
223 0.19
224 0.21
225 0.22
226 0.22
227 0.24
228 0.23
229 0.2
230 0.19
231 0.2
232 0.17
233 0.17
234 0.21
235 0.2
236 0.23
237 0.25
238 0.23
239 0.22
240 0.21
241 0.19
242 0.16
243 0.14
244 0.11
245 0.09
246 0.1
247 0.08
248 0.08
249 0.08
250 0.07
251 0.07
252 0.07
253 0.07
254 0.11
255 0.18
256 0.21
257 0.29
258 0.36
259 0.42
260 0.5
261 0.6
262 0.63
263 0.67
264 0.7
265 0.73
266 0.76
267 0.77
268 0.77
269 0.72
270 0.65
271 0.57
272 0.55
273 0.46
274 0.39
275 0.33
276 0.25
277 0.2
278 0.18
279 0.17
280 0.14
281 0.12
282 0.1
283 0.1
284 0.09
285 0.09
286 0.1
287 0.14
288 0.18
289 0.2
290 0.24
291 0.31
292 0.37
293 0.37
294 0.42
295 0.46
296 0.45
297 0.45
298 0.44
299 0.45
300 0.47
301 0.54
302 0.53
303 0.47
304 0.44
305 0.41
306 0.38
307 0.29
308 0.24
309 0.17
310 0.11
311 0.09
312 0.08
313 0.08
314 0.07
315 0.07
316 0.05
317 0.05
318 0.08
319 0.09
320 0.1
321 0.11
322 0.11
323 0.12
324 0.12
325 0.11
326 0.08
327 0.08
328 0.08
329 0.08
330 0.09
331 0.08
332 0.08
333 0.1
334 0.11
335 0.14
336 0.15
337 0.14
338 0.14
339 0.16
340 0.2
341 0.19
342 0.23
343 0.28
344 0.36
345 0.4
346 0.4
347 0.39
348 0.36
349 0.4
350 0.37
351 0.35
352 0.28
353 0.26
354 0.28
355 0.28
356 0.3
357 0.28
358 0.29
359 0.24
360 0.25
361 0.23
362 0.24
363 0.29
364 0.32
365 0.3
366 0.28
367 0.27
368 0.26
369 0.31
370 0.37
371 0.39
372 0.43
373 0.42
374 0.44
375 0.47
376 0.47
377 0.48
378 0.47
379 0.45
380 0.39
381 0.44
382 0.44
383 0.44
384 0.44
385 0.4
386 0.41
387 0.46
388 0.51
389 0.56
390 0.64